(data stored in ACNUC7421 zone)

EMBL: CP000075.PE78

CP000075.PE78        Location/Qualifiers
FT   CDS_pept        84310..85194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0078"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35152"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35152.1"
FT                   /translation="MIIGEKLHVEALFDTHTWTISYLVMDLHSKQCALIDSVLDYDPKS
FT                   GRTRTESADRMIERAQALGASVQWIFETHVHADHLSAAPYLKQRLGGQIVIGSHITAVQ
FT                   ETFGTLFNAPPDFARNGSQFDVLLEDNASFALGALEVKAMHTPGHTPACMSYLVQVGDA
FT                   TVAFVGDTLFMPDYGTARCDFPGADARTLYRSIKKLLALPPETLLFMCHDYLPNGRELK
FT                   YMTTVAEQRASNIHVHDGVDEDAFVGMREARDATLDMPVLMLPAVQVNMRCGHFPEPED
FT                   NGVVYLKIPLNAL"
     atgattatcg gtgaaaagct tcatgtcgaa gcgctcttcg acacgcatac ctggaccatc        60
     agctatctgg tgatggacct gcacagcaag caatgtgcgc tgatcgacag cgtgctcgat       120
     tacgacccca agtccggccg caccagaacc gagtcggccg accggatgat cgaacgggcg       180
     caggccctgg gcgcctcggt gcagtggatt ttcgaaaccc atgtgcacgc cgatcacctc       240
     tcggcagcgc cgtatctgaa acagcggctc ggtgggcaaa ttgtcatcgg cagccatatc       300
     actgcggtgc aggaaacctt cggcacgctg ttcaacgcgc cgcctgactt tgcccgcaat       360
     ggcagtcagt tcgatgtgct gctggaagac aacgcctcgt tcgccctcgg cgcgcttgag       420
     gtcaaggcca tgcacacgcc cgggcacacg ccggcgtgca tgagttacct ggtgcaagtc       480
     ggtgacgcca cggtcgcgtt tgtcggcgat acgctgttca tgcccgatta cggcaccgct       540
     cggtgcgact tcccgggtgc cgatgcgcgc acgctgtatc gctcgatcaa gaagctgctg       600
     gcgctgccgc cggaaaccct gctgttcatg tgccacgact acctgcccaa tggccgtgag       660
     ctgaaataca tgaccacggt tgccgaacag cgtgccagca atatccatgt gcacgacggg       720
     gtggatgaag acgcgttcgt cggcatgcgc gaagcccgtg acgcgacgct ggacatgccg       780
     gtgctgatgc tgcctgcggt gcaggtcaac atgcgctgcg gccactttcc cgagccggaa       840
     gacaacggcg tcgtctacct gaagatcccg ctcaatgccc tttga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page