(data stored in ACNUC7421 zone)

EMBL: CP000075.PE80

CP000075.PE80        Location/Qualifiers
FT   CDS_pept        86468..87280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0080"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35154"
FT                   /db_xref="GOA:Q500L8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35154.1"
FT                   /translation="MDEHQLLGVGLGTVIGMVLALTGAGGGILAVPLLVFGLGLSIVEA
FT                   APVGLLAVGLAAGIGAVLGLRQGIVRYRAAGYIASIGVLMAPLGLWLAHRLPNTPLALV
FT                   FSAVLLYACGRMFIRASRELRHEKPAPRAEILPCVLNPLQGRLRWTMPCLRALTLTGVG
FT                   SGLLSGLLGVGGGFVIIPALTRYSDLDMKSVVATSLAVIALVSMGSVITASLSGVMHWA
FT                   VGAPFALGAVIGLIIGRQVARYLAGPRLQQLFAVCGIVAAFMLALSVR"
     atggatgagc atcagttgct gggcgttggc ctggggaccg tcatcggcat ggtactggcg        60
     ctgaccggcg cgggcggcgg catcctcgcc gtgccgctgc tggtcttcgg tctcggtctg       120
     tcgattgtcg aagcggcgcc tgtcggtctg ttggccgtag ggctggcggc ggggatcggt       180
     gcggtactgg ggctgcgtca gggcatcgtc cgctaccgcg cggccgggta catcgcgtcc       240
     atcggtgtac tgatggcgcc tctgggcctg tggctcgctc atcgactgcc caatacgccg       300
     ctggcactgg tcttttccgc cgtgctgctg tacgcctgtg gacgtatgtt catcagggcc       360
     agccgcgaat tgcgccacga aaagccggcg ccgcgtgcgg aaatactgcc ctgcgtgctc       420
     aacccgctgc agggccgcct gcgctggacc atgccctgcc tgcgcgcact aacgctgacc       480
     ggcgtgggct ccgggttgct gtccgggttg ttgggagtgg gcggcgggtt cgtgatcatt       540
     ccggcgctga cccgctacag cgatctggac atgaaaagtg tcgtggcgac gtcactggcg       600
     gtgatcgccc tggtctcgat gggcagcgtc attaccgcct cattgagtgg tgttatgcat       660
     tgggcagttg gcgcgccgtt cgcgctgggt gcagtcatcg gcctgattat cggcagacaa       720
     gtcgcccgct acctcgccgg cccacgcctg caacaactgt tcgccgtatg cggcatcgtc       780
     gcggcgttca tgctggcgtt gtccgtgcga taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page