(data stored in ACNUC7421 zone)

EMBL: CP000075.PE82

CP000075.PE82        Location/Qualifiers
FT   CDS_pept        complement(88464..89336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0082"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35156"
FT                   /db_xref="GOA:Q500L6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35156.1"
FT                   /translation="MSYSSVSAAASANAARRGSAVSRRILIGLCWLVFVLFLGLPLFIV
FT                   VSQGLKNGLGAFFIAILEPDALSALKLTVIAVLISVPLNLVFGVSAAWCVSKYSFRGKS
FT                   ILVTLIDLPFSVSPVIAGLVYVLMFGAQGLFGPWLQDHDIQIVFALPGIVLATIFVTVP
FT                   FVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEF
FT                   GAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFAVASLLLILALFILLLKQWSESRIN
FT                   RLRHNAAEE"
     atgtcttatt catctgtctc ggccgccgcc tctgccaacg ccgcccgtcg tggcagcgcg        60
     gtatcgcgac gcatcctgat cggcctgtgc tggctggtat tcgtcctgtt tctgggcctg       120
     ccgctgttca tcgtggtgtc ccagggcctg aaaaacggtc tgggcgcgtt ctttatcgca       180
     atcctcgaac cggacgcgct gtcggcgctg aagctgacgg tcatagcggt attgatctcg       240
     gtgccgctaa acctggtgtt cggcgtcagc gccgcgtggt gtgtgagcaa atactcgttc       300
     cgcggcaaga gcattctggt cacgctgatc gacctgccgt tctcggtgtc gccggtcatc       360
     gccggtctgg tctacgtgct gatgttcggt gcacaggggc tgttcgggcc gtggctgcag       420
     gatcacgaca tccagatcgt ctttgccctg ccgggcatcg tgctggcgac catcttcgtc       480
     accgtcccct tcgttgcccg tgagctgatc ccgctgatgc aggagcaggg cactcaggaa       540
     gaagaagccg cacggctgct gggcgccaat ggctggcaga tgttctggca cgtcacggtg       600
     ccgaacatca aatggggcct gatctacggc gtggtgctgt gtacggcgcg ggcgatgggt       660
     gagtttggcg cggtgtcggt ggtgtccggg cacattcgcg gcgtcaccaa caccctgccg       720
     ctgcacgtcg aaatcctcta caacgaatac aaccacgttg ccgcctttgc cgtggcgagc       780
     ctgttgctga tcctggcgct gttcatcctg ctgctcaagc agtggagcga atcgcgcatt       840
     aaccgtctgc gccataacgc ggcggaggaa taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page