(data stored in ACNUC7421 zone)

EMBL: CP000075.PE83

CP000075.PE83        Location/Qualifiers
FT   CDS_pept        complement(89350..90171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0083"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35157"
FT                   /db_xref="GOA:Q500L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35157.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLIPLAAMFVHAAQLTWDQ
FT                   FWTIITAPRVIAALKLSFGTAFYAALINGVIGTLLAWVLVRYTFPGRKVIDAMIDLPFA
FT                   LPTAVAGIALTALYAPNGWVGQFAADLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPREVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVMMLVVSFILLLLINLLQRRIETPS"
     atgtcgcgtc gtatctcccc cgtcataccc ggcttcgggc tgacgctggg ctacaccttg        60
     gtgtacctca gtctgattgt gctaataccg ctggccgcca tgttcgtaca tgccgcgcag       120
     ctcacctggg atcagttctg gaccatcatc acggcccctc gcgtgatcgc ggcactcaag       180
     ctgagtttcg gcaccgcctt ttacgcagcc ctcatcaacg gggtgatcgg cacactgctg       240
     gcctgggtgc tggtgcgcta caccttcccc gggcgcaagg tcatcgatgc gatgatcgat       300
     ctgccattcg ccctgccgac cgccgtggcc ggtatcgccc tgaccgcgct gtacgcgccc       360
     aacggctggg tcggccagtt cgcggctgat ctgggtttca agatcgccta caccccgttg       420
     ggcatcaccc tggcgctgac cttcgtcacc ctgccgttcg tggtgcgcac cgtgcagcct       480
     gtgctggccg acatcccccg cgaagtcgaa gaggccgccg cctgcctggg cgcgcgtccg       540
     ctacaggtgt ttcgccacat cctcgtcccg gcgttgctgc ctgcctggct gaccggcttc       600
     gccctggcgt ttgcccgtgg cgtgggcgag tacggttcgg tgattttcat cgccggcaac       660
     atgccgatga aaaccgagat cctgccgctg ctgatcatgg tcaagctcga ccagtacgac       720
     tacaccggcg caaccgctat cggcgtgatg atgctggtgg tgtccttcat tctgctgctg       780
     ctgatcaacc tgctgcagcg gcgcattgaa accccatcct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page