(data stored in ACNUC7421 zone)

EMBL: CP000075.PE92

CP000075.PE92        Location/Qualifiers
FT   CDS_pept        complement(101677..102312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0092"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35166"
FT                   /db_xref="GOA:Q500K6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35166.1"
FT                   /translation="MESLQQWLSFAMIALFVTLTPGPAVIMALSNSITHGPARAMVGSL
FT                   GNALGLIVVATAVTAGLGAILVASASAFLVLKIAGAGYLVYLGIKQWRSARSAFDALAN
FT                   VPKAVSTGGLFIKGISVALTNPKAILFFIAFLPQFIQPGTFQVEQTGVLIVTFAGCSVV
FT                   AHIFYVLLAQTLKRHLNSARRRQNVNRVFGASFIGLGLSLFTLKGRAA"
     atggaatcgc tacaacagtg gctcagcttc gcgatgattg ccttgttcgt tacgctcacg        60
     ccggggcctg cggtgatcat ggcgctgtcg aattcaatca cccacgggcc ggcgcgggcg       120
     atggtcggtt cgctcggcaa cgccttgggg ttgatcgtgg ttgccacggc ggtaacggcc       180
     gggctgggcg cgattctggt agcgtcggcc agtgcctttc tggtgctgaa aatcgctggc       240
     gcggggtatc tggtttatct ggggatcaag cagtggcgta gcgcgcgcag tgcatttgat       300
     gcgctggcga acgtgcccaa agcggtgtcc acagggggcc tgtttatcaa aggtatctcg       360
     gtggcgctga ccaaccccaa ggcgattctg tttttcatcg cgtttctgcc gcaattcatc       420
     cagcccggca cctttcaggt ggagcagacg ggcgtgctga tcgtgacctt cgccggctgc       480
     tctgtggttg ctcacatctt ttatgtgctg ctggcacaga cgctcaagcg ccacctcaat       540
     tcggcccgca ggcgccagaa cgtcaatcgg gtgtttggcg cgtcgtttat tggtctgggg       600
     ttgagcctgt tcacgttgaa gggcagggcc gcctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page