(data stored in ACNUC7421 zone)

EMBL: CP000075.PE97

CP000075.PE97        Location/Qualifiers
FT   CDS_pept        108211..109452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35171"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35171.1"
FT                   /translation="MSEENGYMEGFHDPIRHLKYLRQSLSQDNESIGFFLSAGCPLSVN
FT                   MPTDEWPLIPDVANLTKFINSQLVENVQYKTLLAELVKAERNSENIEDTLSFLRSLLTV
FT                   SKGGDVRGLSEANLLDLEKKICKIIVKKIDVLLPSQDTPYHQLCKWIRSIDRKTPVEIF
FT                   TTNYDLLMEQSLEDLEVEYFDGFVGARRSFFDLRALEDNLIPVHWSRLWKIHGSINWYK
FT                   EEVSGQKKVYRSSEIKEDASHLIYPSHLKYEESRKMPYLALIDQLNRFIRKKSSLLIMS
FT                   GYSFNDGHLNDTIINALKANPTAMVLALMYGNFEDQLPDGLAKEKYPEAYRLAKNQHNL
FT                   NIWTFNKAIIGTNPGRWSIFPENDDTDLDIRTFITSIKIDDTSGKTENIIKLGDFAVFT
FT                   SFLKRIIGSASGAN"
     atgtcagagg agaacggcta catggaaggc tttcatgatc ctattaggca tttaaaatat        60
     cttcgacaat ctttgtcaca agataatgaa tcaatcggct tttttttgtc tgcgggatgt       120
     cctctctcgg taaatatgcc aacagatgaa tggccattaa ttcctgacgt agcaaacctt       180
     acaaagttta ttaacagcca gttggtggaa aacgttcaat ataaaactct tttggctgag       240
     ctggttaagg cggaacgaaa ctctgaaaac atagaagaca cactaagctt cttaagaagc       300
     ctcttaactg tatccaaagg tggagacgtt agaggtttaa gtgaggctaa tcttttagat       360
     cttgagaaaa aaatctgcaa gatcattgtt aaaaaaattg atgtattact tccaagtcaa       420
     gacactccat atcatcagct gtgcaagtgg atacgatcta tagacagaaa aacccccgtc       480
     gaaatattta ccacgaatta cgacttgcta atggaacaat cacttgagga tcttgaagtt       540
     gagtatttcg atgggttcgt gggggcccgt agatcgtttt ttgacttgcg tgctctagaa       600
     gataatctaa tacccgttca ttggtctaga ctttggaaaa ttcacggttc aattaactgg       660
     tacaaggaag aagtatctgg ccagaagaaa gtctatcgat cttcggagat aaaggaggac       720
     gcatcccact tgatttatcc ttcgcactta aagtatgaag aaagccgaaa gatgccttac       780
     cttgctctca tagaccaact aaatagattt attcgtaaaa agtcttcatt gctaataatg       840
     tcaggctact cgtttaatga tggccactta aatgacacta taataaacgc tttaaaagca       900
     aaccctacag cgatggtgct ggcgctgatg tatgggaact tcgaagatca acttcctgac       960
     gggttagcta aagaaaagta ccctgaagca tatcgattag caaaaaacca gcacaatcta      1020
     aatatttgga cattcaataa ggctattatt ggcacgaacc cagggcggtg gtccatattt      1080
     cctgaaaacg acgatactga cctggatatc agaacattca ttacttctat caagattgat      1140
     gacacatcag gcaagacaga gaacattatc aaacttggtg acttcgctgt ctttactagc      1200
     tttttgaaaa ggataatcgg ctcagcatca ggggcaaatt aa                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page