(data stored in SCRATCH zone)

EMBL: CP000075.PE99

CP000075.PE99        Location/Qualifiers
FT   CDS_pept        111332..111541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0099"
FT                   /product="Conserved hypothetical protein"
FT                   /note="similar to BCE2369 and YPTB2343"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35173"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J9"
FT                   /protein_id="AAY35173.1"
FT                   /translation="MERSPVSSSNVESVGYDEDSETLEVEFKNGTLYQYFDVPQSAFDG
FT                   LVNADSPGGYLAENIKGVYRYSRV"
     atggaacgaa gcccggtgtc atcttcaaac gtagagtctg taggctatga cgaagacagt        60
     gaaactttag aggtggagtt taaaaatggt acgctttacc aatacttcga tgtaccacaa       120
     agtgccttcg atggattggt aaatgccgac tcgcctggag gttacctagc cgaaaacatt       180
     aaaggcgtgt atagatattc tcgagtttga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page