(data stored in ACNUC7421 zone)

EMBL: CP000088.PE101

CP000088.PE101       Location/Qualifiers
FT   CDS_pept        125036..125299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54141"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54141.1"
FT                   /translation="MGRQCRLPRVFRHTWGSRGWDRSAESRKGTTVTTPEENRPKTRGT
FT                   EQTLPEPDVQAPKLPQPRPTLGAELEDAMRRSGLSREDFGKE"
     gtgggcaggc agtgccgtct gccacgtgtg ttccggcata cctggggtag ccgggggtgg        60
     gacaggtctg cagagagcag aaagggaacg actgtgacca ctcccgagga gaaccggccg       120
     aagacccgcg gcaccgagca gacactcccg gagcccgatg tgcaggctcc gaagctgccg       180
     caaccccgcc ccaccctggg cgcggaactg gaagatgcga tgcggcggtc cggactctcc       240
     cgtgaagact tcgggaagga gtag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page