(data stored in ACNUC7421 zone)

EMBL: CP000088.PE104

CP000088.PE104       Location/Qualifiers
FT   CDS_pept        complement(128454..130466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0106"
FT                   /product="PAS protein phosphatase 2C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54144"
FT                   /db_xref="GOA:Q47TS0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54144.1"
FT                   /translation="MFDLAPIGVSITRGPDHRLVYVNEAQRAIFGPRPLGKPLLQAFND
FT                   LAEAGYILVLDQVMTTGKPEFLPQVPVTVNYPNAGRQERYFNLSFTPVFLDDGEPAVLN
FT                   LIADVTETIDAAQRKRALQRYTSIVRSGSLVEWSASPIDGSLQWIRGWEEITGQPHEES
FT                   RGHGWLNMVAPEDRAALLASWLRAIDEVPDSVEYIFRVRTRDGTYRHFRAHAVPVRENG
FT                   VVVEWTGTCADVEQQWREQRRHALFNRASGAISNTALIEDMLKALPEVIVPEVADVCTV
FT                   HLLSPTSSPETSANPFIVERLATKAREGITVPPPRFQSRFTIRSTYLELIRQKRSIHRV
FT                   FPVGKPPLDPLSPNSSRWLRQVKANSVVMLPITVEGELVASLVAVVCGEREPLTQDDAD
FT                   LLADLIDHLQPTIDTFASFQRTQRVARALQHSLLSDPPTIPGLPIVGRYQTSPTSAEVG
FT                   GDWYDAFIVDDTIMLVIGDVAGHDLTAATAMSQMRNMLRAFAADHPHNPHEVLRRLDGA
FT                   VQRSGEYKGTATCILARVTPDSDGIWQVDYSVAGHLPPLLVLPNGETRFLEKAHDLLLG
FT                   VDPTMPRHRALEVLPSGATLLLYTDGLVEHPHESLDIGLERLAHHCAAMARIPLNTFCD
FT                   RLLTELPIAGNDDITLIALRLESPTLATASLARHG"
     atgttcgacc tggcccctat cggggtgtcc atcacccgtg gccccgacca ccgcctggtc        60
     tacgtcaacg aagcacaacg agccatattc ggcccgcgcc cactcggcaa acccctgctg       120
     caagccttca acgaccttgc cgaagcggga tacatccttg tcctcgacca ggtcatgacc       180
     accgggaaac ccgaattcct cccccaagtc cccgtaaccg tcaactatcc caacgccggc       240
     cgccaagaac gctacttcaa cctcagcttc accccggtgt tcctggacga cggagaaccc       300
     gcagtactga acctgatcgc ggacgtcacc gaaaccatcg acgccgccca gcggaaacgc       360
     gccctccagc ggtacaccag catcgtccgc tccgggagcc tggtggaatg gagcgcctcc       420
     cccatcgacg gctccctgca atggatccgc ggctgggagg agatcactgg gcaaccccac       480
     gaagaatccc gaggccacgg ctggttgaac atggtcgccc cagaagacag ggccgcgctg       540
     ctcgcgtcct ggctacgggc aatcgacgaa gtccccgact ctgtggagta catcttccgg       600
     gtacgaacac gcgacggcac ctaccggcac ttccgtgccc atgccgtccc cgtccgagaa       660
     aacggggtcg tcgtcgaatg gaccggcacc tgcgccgacg tggaacaaca atggcgggag       720
     cagcgccgcc acgccctgtt caaccgtgcc tctggggcga tctccaacac cgccctcatc       780
     gaagacatgc tcaaggcgtt acccgaggtc atcgtgcccg aggtcgccga tgtgtgcacg       840
     gtccacctgt tgtcccccac ctcatcgcct gaaacatcag cgaacccgtt cattgtggaa       900
     cgcctggcga ccaaagcccg ggaagggatc accgtgccgc cgccacggtt ccagtcacgc       960
     ttcaccatcc gaagcacata cctcgagttg atccggcaga agcgctccat ccaccgggtg      1020
     ttcccggtag gaaagccgcc cttggaccct ctcagcccga atagctcgcg gtggctccgc      1080
     caagtcaaag ccaacagcgt ggtcatgctc cccatcacgg tcgaggggga actcgtcgct      1140
     agcctggtcg cagtcgtctg cggggaacgc gaaccgctga ctcaagacga cgcggacctc      1200
     ctggcggacc tcatcgacca cctccagccc accatcgaca cgttcgcgag cttccaacgc      1260
     acccaacggg tcgcgagagc cctccagcac agcctgctca gcgatccccc caccatcccg      1320
     ggtctcccta tcgtcggccg ctatcagacc agccctactt ccgcggaggt gggcggtgac      1380
     tggtacgacg cgttcatcgt cgacgacacg atcatgctcg ttatcgggga cgtggccgga      1440
     cacgacctga ccgcggccac cgccatgagc cagatgcgca acatgctccg cgctttcgcc      1500
     gccgaccacc cgcacaaccc tcacgaagtg ctacgccgcc tggacggcgc agtgcaacgc      1560
     tccggggagt acaaagggac ggccacctgc atcctcgccc gggtcacccc agacagtgac      1620
     ggcatctggc aggtggacta ctcggtggcc ggacacctgc cgccgctgct cgttctcccg      1680
     aacggggaga cccgcttctt ggagaaagcc cacgaccttc tcctcggcgt ggaccccaca      1740
     atgccgcgcc accgggcgct cgaagtcctg ccctcgggag ccaccctgct gctctacacc      1800
     gacggtctcg tggaacaccc ccacgagtct ctcgatatcg ggttggagcg gctggcccac      1860
     cactgtgccg ccatggcccg gattcccctc aacacgttct gcgaccggct cctcactgag      1920
     ctgcctatcg ccggaaacga cgacatcact ttgatcgcgt tgcggttgga gtcgcctacc      1980
     ctggccacag cctccctggc ccggcacggc tga                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page