(data stored in ACNUC7421 zone)

EMBL: CP000088.PE106

CP000088.PE106       Location/Qualifiers
FT   CDS_pept        131789..132292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54146"
FT                   /db_xref="GOA:Q47TR8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54146.1"
FT                   /translation="MGKIAWSSPEGASSIPGMSELKTRLQADLTAAMKARDAVRTRALR
FT                   MLLTAISNEEVSGKSARELSDDEIIKVITKEVKKRREAAEAFEQGGRADRAADERAEGE
FT                   VLSEYLPEQLSDEELADLVRAAIAEAGVSDVKGMGAVMKLLTPRVAGRAEGRRVADEVR
FT                   RQLS"
     atgggaaaaa ttgcctggag ttccccggaa ggggcctcta gcatccctgg catgtccgaa        60
     ctaaagaccc ggctgcaagc cgaccttacc gctgcgatga aggcacggga cgctgtgcgg       120
     actcgggcgc tgcgcatgct gctcaccgcg atctccaacg aggaggtgtc ggggaagtcc       180
     gcccgtgagc tcagcgacga cgagatcatc aaggtgatca cgaaggaagt gaagaagcgt       240
     cgcgaggccg cggaggcttt cgagcagggt gggcgcgcgg accgggcagc ggacgagcgt       300
     gccgaaggcg aggtgctgtc cgagtatttg ccggagcagc tcagcgacga agagctggct       360
     gatctggttc gggcggcgat cgcggaggcc ggggtgagcg acgtcaaggg gatgggcgcg       420
     gtgatgaagc tgctcactcc ccgggttgcg gggcgtgctg agggccgccg ggtcgctgac       480
     gaggtgcgcc gccagttgtc gtga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page