(data stored in ACNUC7421 zone)

EMBL: CP000088.PE108

CP000088.PE108       Location/Qualifiers
FT   CDS_pept        135242..135550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0110"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54148"
FT                   /db_xref="GOA:Q47TR6"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54148.1"
FT                   /translation="MWSTDWAARAACREIDPDSLFVQGAAQNRAKLICRGCPVRTECLA
FT                   DALDNRIEFGVWGGMTERERRALLRRRPEVTSWRALLEDARQHYQQSGAAKDQFVKG"
     atgtggagta cagactgggc tgcgcgtgct gcctgtcggg agatcgaccc cgactcgctg        60
     ttcgtccagg gggccgcgca gaaccgggcc aaactcatct gccgggggtg cccggtccgc       120
     accgagtgtc tggctgacgc gctggacaac cggatcgagt tcggtgtctg gggagggatg       180
     accgaacgcg agcggagggc tctgctgcgg cgccgccccg aggtgacctc gtggcgggca       240
     ctgctcgaag acgcccggca gcactaccag cagtccgggg ctgctaagga ccagttcgtc       300
     aagggttga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page