(data stored in ACNUC7421 zone)

EMBL: CP000088.PE112

CP000088.PE112       Location/Qualifiers
FT   CDS_pept        138260..138727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54152"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54152.1"
FT                   /translation="MTTKTPETRLAELGHTLPEVVPPVAAYLPTVRSGSHVYVSGQLPV
FT                   VGGELRATGKVGADVDPEQAKELAAVCALNAIAAIKAEVGELSRVKRVVKVVGFVASDP
FT                   SFTGQPQVINGASELFTEVFGEAGKHARSAVGVAVLPLNAPVEVEVIVEVD"
     atgacgacga agacccctga gacacgattg gcggagctcg ggcacaccct gcccgaggtg        60
     gtccctcccg tggccgcata cctgccgacc gtgcgcagcg ggagccacgt ctacgtctcc       120
     gggcagcttc cggtggtcgg cggggagctc cgtgcgaccg gcaaagtggg ggccgacgtc       180
     gacccggagc aggccaagga gctggccgcg gtgtgcgcgt tgaacgcgat cgccgccatc       240
     aaagccgagg tgggcgaact gtcccgggtg aaacgcgtgg tcaaggtcgt gggattcgtg       300
     gccagcgacc cgtcgttcac cggccagccg caggtcatca atggggccag tgaactgttc       360
     accgaggtgt tcggcgaagc cggcaagcat gcgcgtagcg cggtgggtgt ggccgtgctc       420
     ccgttgaacg ccccggtcga ggttgaggtg atcgtcgagg tcgactag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page