(data stored in ACNUC7421 zone)

EMBL: CP000088.PE113

CP000088.PE113       Location/Qualifiers
FT   CDS_pept        138774..139706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54153"
FT                   /db_xref="GOA:Q47TR1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54153.1"
FT                   /translation="MSANHSECRREEEEKPSSAPVSPSEEATLSEGEVIRHLGSGEITP
FT                   RMWDVLAGRVTPVRPRDAATVLLVRQADRGLEVYLLRRVASMRFAPGMYAFPGGSVDPR
FT                   DSDHTIRWSGPPPREWARAFGADEALARALVCAAVRETFEESGVLLAGPSENEVVADTR
FT                   GDDWEEDRQALLNRSLSLAELLDRRGLVLRSDLLCPWARWITPAMEPRRYDTRFFVAVL
FT                   PEGQQPRDVGGEADHVTWMSPEEAVRQWRAGQLAMLPPTVANLKSLIGYATPEEVLAAE
FT                   REIVPVQPEFRKSAGGITLIVPDGVDYPF"
     gtgtcagcga accattcaga atgccggcgg gaagaagagg agaagccttc ctccgctccc        60
     gtgtctccct ccgaagaagc gactctctcg gagggtgagg tcatccgcca ccttggcagc       120
     ggcgagatca ctccccgcat gtgggacgtg ctcgcggggc gggtgactcc ggtgcggcct       180
     cgggacgccg cgaccgtgct gctggtgcgt caggcagatc gaggtctcga ggtgtacctg       240
     ctgcggcggg tcgcttcgat gcggttcgct ccgggcatgt acgccttccc cggggggtcg       300
     gtggatccgc gggacagcga ccacacgatc cgctggagcg ggccgccgcc ccgggagtgg       360
     gctcgcgcgt tcggggcgga cgaggcactg gcgcgcgccc tcgtctgcgc ggcggtacgg       420
     gaaacctttg aagagtccgg ggtgctgctg gccggtccct ccgagaatga agtggtagcc       480
     gatacgcggg gggacgactg ggaggaagac cggcaggcgc tgctcaaccg ttccctgtcg       540
     ctcgcggaac tgcttgaccg gcgagggctg gtgctccgct cggatctact gtgtccgtgg       600
     gcgcggtgga tcaccccggc gatggagccg cgccgctacg acaccaggtt ctttgtcgcg       660
     gtcctgccgg aaggccagca gcctcgcgac gtgggcgggg aagccgacca tgtcacgtgg       720
     atgtccccgg aggaggcggt gcggcagtgg cgggcggggc agttggcgat gctgccgccc       780
     acggtggcca acctgaagag cctcatcgga tacgccacac ctgaggaggt gttggccgcg       840
     gaacgggaga tcgttccggt gcaaccggag ttccggaagt ctgcgggggg aatcacgctg       900
     atcgttcccg atggtgttga ttatccgttc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page