(data stored in ACNUC7421 zone)

EMBL: CP000088.PE115

CP000088.PE115       Location/Qualifiers
FT   CDS_pept        complement(140729..141415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0117"
FT                   /product="Cyclic nucleotide-binding:Bacterial regulatory
FT                   protein, Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54155"
FT                   /db_xref="GOA:Q47TQ9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54155.1"
FT                   /translation="MVDETNEVLSKAPLFEALDEEGAAALRSSITEVRLGRGQTLFSEG
FT                   DEGDRLYVMLSGKVKLTRKSADGRENLLAVLGPGEMLGELSLFDPGPRTASAVAVTDAV
FT                   LAGLGHDDLRPFIMRQPEVAVHLLKALATRLRRTNDVVADLVFTDVPGRVAKALLDLAE
FT                   RFGKQSEDGLHVHHDLTQEELAQFVGASRETVNKALAEFALRGWLRIEAKAVVLLDVER
FT                   LRRRAR"
     atggtggacg agaccaacga ggtgctgagc aaggcccccc tgttcgaggc gcttgacgaa        60
     gaaggcgcgg ccgcgctgcg ttcttccatc accgaggtgc gactcggccg gggccagaca       120
     ctcttctccg agggagacga gggtgaccgt ctctacgtca tgctcagcgg aaaggtcaaa       180
     ctcacccgca agtccgctga cggccgtgag aacctgctgg cggttctcgg cccgggcgaa       240
     atgctgggtg agctctccct gttcgacccg ggaccgcgga cggccagcgc ggttgcggta       300
     accgacgctg tgttggccgg gctgggccac gacgacttgc ggccgttcat catgcggcag       360
     cccgaggtcg ccgtccacct gctgaaggcg ctggccaccc gactgcggcg gaccaacgac       420
     gtggtggcgg acctggtctt caccgacgtt cccggccgtg tcgccaaggc cctgctcgac       480
     ctggcggaac gtttcggcaa gcagagcgag gacgggctcc acgtccacca cgacctgacg       540
     caagaagagc tggcccagtt cgtgggcgcg tcacgcgaaa ccgtcaacaa ggcgctggcc       600
     gaattcgcgc tgcgcggctg gctgcggatc gaagccaaag ccgtggtcct gctcgacgtg       660
     gaacggctgc gtcgccgcgc ccgctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page