(data stored in ACNUC7421 zone)

EMBL: CP000088.PE124

CP000088.PE124       Location/Qualifiers
FT   CDS_pept        complement(148982..149722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0126"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54164"
FT                   /db_xref="GOA:Q47TQ0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54164.1"
FT                   /translation="MTGLDVAVIALAAGTGALAVGDGRSPAERRLAALSAPALRRPPRL
FT                   LPRLPRMLAAAAVLAACWALGGAGLGLFGSALLAGFVVWRRKRAAASPPSAGRDTEITA
FT                   VLPLALDLLAAGLRAGAHPTDMVAAVAQALGGPLGTALDGVARQLRLGADPARAWQSLH
FT                   APAELAAVGRALARASHTGAPLADVVESHAADCRRTARATALELAHRTGVAVVIPLGVC
FT                   FLPAFVLLGVVPLAAGLVSGLVLP"
     gtgacgggtc tcgatgtcgc tgtcatcgcg ctggccgctg gaacgggcgc gctcgcggtc        60
     ggagacggcc ggtcgcccgc agaacggcgg ctcgccgcct tgtcggcccc tgccctacgc       120
     cgcccacccc ggcttctgcc ccggcttccc cgcatgctcg ccgctgctgc cgtactcgcg       180
     gcctgctggg cgctgggcgg ggcaggactc ggcttgttcg ggagcgcact cctcgccggg       240
     ttcgtggtgt ggcggcggaa acgggccgca gcgtccccac cgtccgccgg gcgggacacg       300
     gagatcacgg ccgtgctgcc cctggccctg gacctgttgg cggccgggct gcgcgcggga       360
     gcacacccca ccgacatggt ggcggcggta gcccaggctc tcggcgggcc gctcggtacc       420
     gcgctggacg gggtggcccg gcagttacgg ctcggcgccg atccggcgcg cgcctggcag       480
     agtctgcacg cccccgcaga gctggccgcg gtaggccggg ccctggcccg ggcaagccac       540
     actggcgccc cactggccga cgtggtggag tcccacgccg ccgactgccg ccgtaccgcc       600
     cgcgcgacag ccctcgagct ggcccaccgc accggggtag ccgtcgtcat ccccctgggt       660
     gtgtgctttc tgcccgcgtt cgtcctcctc ggcgtggtgc ccctggccgc gggcctcgtg       720
     tctggtctgg tccttccctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page