(data stored in ACNUC7421 zone)

EMBL: CP000088.PE127

CP000088.PE127       Location/Qualifiers
FT   CDS_pept        complement(151683..152777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0129"
FT                   /product="putative septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54167"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54167.1"
FT                   /translation="MPSTSSARPLFLTDDPALLDDLLRLAAAANVDVTVVSSAARSSRY
FT                   WAQAPLVVVGTDLVGVLARAEPPRHAHAVVVSRTPLSPALDFSVYPDAMRIGARDVLVL
FT                   PDAEQQLVALLTESTDHAGEEALVVSVIGGRGGAGASLLAAALALAGHRAGLRTALVDA
FT                   DPLGGGLDILLGAEHVPGSRWEEFSNRQGRMLWPALRDSLPHIHGLPVVTWTRHGPYAP
FT                   IPPQAMRTVLHAATRGCQMLVVDLPRALDAAAEEVLRRTTVALMILPAEVSAVVAAERL
FT                   LPALRDSVADLRLVVRGATPDILSAESVASSLKLPLAGDLPDDTELPRLLDQGELPTRR
FT                   TRSPLVAFSEAFVAHLCPERVRSA"
     atgccgtcca catcttccgc acgtcccctg ttcctcaccg acgatccggc gctcctcgac        60
     gacctgctcc gcctcgctgc cgcagccaac gtcgacgtca ccgtggtctc ctctgcggca       120
     cggagcagcc gctactgggc gcaggcacct ctcgtcgtcg tcggcaccga cctggtgggc       180
     gtgctcgccc gcgccgaacc gccccggcat gcgcacgcgg tcgtggtcag ccgcaccccc       240
     ctctccccgg ccctggactt cagcgtctac cccgacgcca tgcggatcgg cgcccgagac       300
     gttctcgtcc tacccgatgc agaacagcag ctggtggcgc tcctcaccga atccaccgac       360
     catgccgggg aagaagccct ggtcgtctcc gtgatcggcg gccggggcgg ggccggagca       420
     agcctgctcg ccgcggcact cgcgctcgcc gggcaccgtg ccggactgcg caccgcactg       480
     gtcgacgccg atccgctcgg cggaggactc gacatcctgc tgggtgccga gcacgtgccc       540
     ggatcccgct gggaggagtt cagcaaccga cagggacgca tgctctggcc agcactccgc       600
     gactcgctgc cccacatcca cggtcttccc gtggtgacct ggacccggca cggcccgtac       660
     gccccgattc ccccacaagc catgcgcacc gtgctccacg ccgctacccg gggatgccag       720
     atgctggtcg ttgacctgcc ccgggccctc gacgccgctg cggaagaagt actgcgccgc       780
     accacggtcg ccctgatgat cctccccgct gaagtgtctg ccgtcgtggc cgcggaacgg       840
     ctgctgcccg ccctccggga ctccgttgcg gacctgcggc tggtggtccg cggcgcaacc       900
     cccgacatcc tgtccgcgga atcggtggcg tcctcgctca aactgcccct cgccggagac       960
     ctccccgacg acactgaact gccccgcctc ctcgaccaag gggaactgcc cacgcgccgc      1020
     acccggtccc ctctcgtcgc gttcagcgaa gcattcgtcg cccacctgtg cccggaacgg      1080
     gtccggtcgg catga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page