(data stored in ACNUC7421 zone)

EMBL: CP000088.PE128

CP000088.PE128       Location/Qualifiers
FT   CDS_pept        complement(153502..154314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54168"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54168.1"
FT                   /translation="MNAVPTDPLMRIAEIPEVARAVDETRSLVDMLIGQRVLRRRGSDV
FT                   SMEAALRGARASAVLEGADVSLEQVRFGESDDPRVRGSVRVSGELGLLVETWSKAPRQV
FT                   LARLHVLAASDVVAPEALGRPRRDGDDVTDPLELGSPPPASEVIARLEALTSLLTARTE
FT                   APAVVVGAIVHGELLALRPFGWGDGIVARAAERLTLMARGLDPNSLVPTQLGHEQRREH
FT                   YAAALRGYMTGTPEGVAGWVVHCAQAVMEGARDSLATCEAIRRATTRR"
     gtgaacgctg tgccgaccga tcctctgatg cggatcgccg aaattcccga ggtcgctcgc        60
     gcggtcgatg aaacccgcag cctcgttgac atgctgatcg ggcaacgggt gctgcgccgc       120
     cgcggcagcg acgtctccat ggaagcggct ctgcgcgggg cccgtgcctc agccgtgctg       180
     gaaggagccg acgtctccct cgagcaggtg cgcttcgggg agagcgacga tccccgggtg       240
     cgggggtcgg tgcgggtctc cggggagctc gggctgctgg tggagacctg gtctaaggcg       300
     ccccgccagg tcctggcccg cctgcacgtc ctggccgcct ccgacgtggt cgcgcccgaa       360
     gcgctgggcc gtccccgccg cgacggggac gacgtgaccg atcccctcga gctgggctcg       420
     ccgccgcccg cgtccgaagt catcgcccgg ctggaggcgt tgacttccct gctcactgcg       480
     cggaccgagg cgcctgccgt ggtggtcggc gcgatcgtgc acggggaact gctggcgctg       540
     cgccccttcg gctgggggga cggcatcgtc gcgcgcgccg cggaacggtt gaccttgatg       600
     gcgcgcggcc tggaccccaa ctcgctggtc cctacccagt tggggcacga gcagcgccgt       660
     gagcactacg ctgctgcgct gcgcggctat atgaccggga ccccggaggg tgtggcgggg       720
     tgggtagtgc actgcgcaca agcggtcatg gaaggggcac gcgactcgct tgccacctgt       780
     gaagccatcc ggcgcgccac gacccgacgc taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page