(data stored in ACNUC7421 zone)

EMBL: CP000088.PE129

CP000088.PE129       Location/Qualifiers
FT   CDS_pept        154466..154927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54169"
FT                   /db_xref="GOA:Q47TP5"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54169.1"
FT                   /translation="MCPMEGAAAVSKTNTGGRKPVDVDAPRRSLGELTSEVTGHLSHLV
FT                   SLQLELARTELAADVRRVVQGTALVITAALVAHLILILASMTIAFALIAFGLPGWLAFL
FT                   IVTLVYTLVAVILGIVGVRSYKKIRGMPRSKETFDKTKAVLRREHTAQQ"
     atgtgtccga tggaaggagc cgccgcggtg tccaaaacca acacgggtgg ccggaagccg        60
     gtggacgtcg acgcgccccg gcgttcactg ggagaactca cctctgaggt gaccggtcac       120
     ctcagccatc tggtgagcct gcagcttgaa cttgctcgga cggagctggc cgcggacgtc       180
     cgccgggtcg tccaagggac cgcgctggtc atcaccgctg ccttggtcgc gcacctgatc       240
     ctcattctgg cttcgatgac gatcgcgttc gcgttgatcg cgttcggtct gcctggatgg       300
     ctggccttct tgatcgttac ccttgtgtac acgctggtgg cggtcatcct cgggatcgtc       360
     ggtgtgcgct cctacaagaa gatccgcggg atgccgcggt cgaaggagac cttcgacaag       420
     accaaggccg tactgcgtcg cgaacatacc gcgcaacagt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page