(data stored in ACNUC7421 zone)

EMBL: CP000088.PE135

CP000088.PE135       Location/Qualifiers
FT   CDS_pept        complement(161378..161992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54175"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54175.1"
FT                   /translation="MDLERLRASDADRERSAEVLRNALAEGRINHEELDERLDRVYRAT
FT                   TVGELAEITRDLPSSLGASPASGTDPSLSSAEAQQLAAQSRGKEAISAVFGGVERAGRW
FT                   LVEPHTTVSILCGGVDLDLREAVLAQREVVFQCAVIFGGLRIIVPPGVRVVNQANVFLG
FT                   GVDLSKVDSVTDPSAPTIRITGTCLMGGIQVLEQRPGQKCR"
     atggacctgg aacgtctccg cgcctctgac gcggaccgcg agcgcagcgc cgaagtgctc        60
     cgcaacgcgc ttgcggaagg ccgcatcaac cacgaggaac tcgacgaacg gttggaccgg       120
     gtgtaccggg cgaccactgt gggggaactc gccgaaatca cccgcgacct tccctcatcg       180
     ctcggcgcgt cgcctgcttc ggggacggac ccgtcgctgt cctccgcgga ggcgcagcaa       240
     ctggccgcgc aaagccgggg gaaagaagcg atttccgcgg tcttcggcgg ggtggagcgt       300
     gcgggacgct ggctggtgga gccgcacacc accgtgtcca tcctgtgcgg tggggtggac       360
     ctggacctgc gggaggcggt gctcgcccag cgcgaagtcg tcttccagtg cgcggtgatc       420
     ttcggcgggc tgcggatcat cgtgccgccc ggcgtgcggg tggtcaacca ggccaatgtc       480
     ttcctgggcg gagtggacct cagtaaggtg gacagcgtca ctgatccgag cgccccgacg       540
     atccggatca ccgggacctg cctgatgggt ggcatccagg tgctggaaca gcgccccggc       600
     cagaagtgca ggtga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page