(data stored in ACNUC7421 zone)

EMBL: CP000088.PE138

CP000088.PE138       Location/Qualifiers
FT   CDS_pept        163958..164710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0140"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54178"
FT                   /db_xref="GOA:Q47TN6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54178.1"
FT                   /translation="MNAWEACVVFAAGAGAGAINTLVGSGTLFTFPALLACGISPVTAM
FT                   ISNSIGLTPGSIAGVIGYRRELAGQRARVLRFGGMSFLGALTGGTLLLTLPERVFTSIA
FT                   PVLILFACALIIFQPQISARLQERRAARPHGGPLLPLGVYGAGVYGGYFVAAQGVILIS
FT                   LLSSSLNDEMQRLNALKNVLALIVNASVALFYLVLAEPHWGAVALISTGSVIGGYFAAK
FT                   FGRRLRPGALRALIVVIGLTAAVQLVLR"
     gtgaacgcgt gggaggcatg cgtcgtcttt gctgcgggtg ccggggcggg agccatcaac        60
     acgctggtgg gctccggtac gctgttcact tttccggcgc tgctggcgtg cgggatttct       120
     ccggtgacgg ccatgatctc caacagcatc ggactcaccc cggggtcgat cgccggagtg       180
     atcggctacc gcagggagct ggctgggcag cgcgcccgag tgctgcggtt cggcgggatg       240
     tcgttcctgg gggcgctgac cggcggaacc ctgctgctca ctttgccgga gcgggtgttc       300
     acgtcgattg cgcctgtgct catcctgttc gcctgcgcgc tcattatttt ccagcctcag       360
     atcagcgcgc ggctgcagga gcgtcgtgcg gcccgccccc acggcggccc gctgctgccg       420
     ctcggcgtct acggggcggg cgtgtacggc gggtattttg tcgccgctca gggcgtcatc       480
     ttgatcagcc tgcttagcag ttccctcaat gacgagatgc agcgcctcaa cgcgttgaag       540
     aacgtgctgg cgctgatcgt caacgcgtcg gtggccctgt tctaccttgt cctggctgaa       600
     ccccactggg gggcggtggc gctgatctcc accggttcgg tgatcggggg gtattttgcc       660
     gcgaagttcg gccgccggct ccgcccgggg gcgctgcgcg ccctgatcgt cgtcatcggc       720
     ctcaccgcag cagtccaact ggtgctgcgg tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page