(data stored in ACNUC7421 zone)

EMBL: CP000088.PE144

CP000088.PE144       Location/Qualifiers
FT   CDS_pept        170878..171678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0146"
FT                   /product="Surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54184"
FT                   /db_xref="GOA:Q47TN0"
FT                   /db_xref="InterPro:IPR005528"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54184.1"
FT                   /translation="MRKTTFASAAVLAAGLAVGFASPASADQAVSGNQIIIPVDVALDV
FT                   CGNTVAVLGDAQGACQSFVDALKSASGGAVTLQSNQGGGLANGNQIVIPVNVALNVCGN
FT                   TITALGEAKGTCDTIVEALEDAADDVVNSSDVPSDGSGGGLLNDNKIAVPIDADVDVCG
FT                   NAVSVLGSAESDCPEEDTAAPNKPAEPEQPGGGSEQPKPDEGGEKPAADDKPAEDAKPA
FT                   PAAEDTLPVTGAALGGLVAAAVAALGGGGAAMYFTRRKRNASEN"
     atgcgtaaaa ccacgtttgc ctcggctgct gtacttgcgg ccggtttggc ggtcggattc        60
     gcctctcccg cctctgcgga tcaggccgtc agcggcaacc agatcatcat tccggtggac       120
     gtcgctctcg acgtctgtgg caacaccgtt gccgtactcg gcgacgccca gggcgcctgc       180
     cagtcgttcg tcgacgccct gaagtcggcg tccggcggag cagtcacgct ccagagcaac       240
     cagggcggcg gtctcgccaa cggcaaccag atcgtgatcc cggtgaatgt cgccctcaac       300
     gtctgcggca acaccatcac cgccctcggt gaggccaagg gcacctgcga caccatcgtc       360
     gaagcgttgg aggacgccgc ggacgacgtg gtgaacagca gcgacgtccc ctccgacggc       420
     tctggcggcg gccttctcaa cgacaacaag atcgccgttc cgatcgacgc cgacgtcgac       480
     gtctgcggga acgcggtctc ggtcctcggc tcggccgagt ccgactgccc ggaagaggac       540
     accgccgccc cgaacaaacc cgcggagcct gagcagcccg gcggcggcag cgagcagccc       600
     aagcccgatg agggcggcga aaagcccgcc gccgacgaca agcccgcgga agacgccaag       660
     cccgctcccg cggctgagga caccctgccg gtgaccggtg cggccctcgg cggcctggtt       720
     gccgctgctg tcgcggctct gggcggcggc ggtgcggcca tgtacttcac gcggcggaag       780
     cggaacgcaa gcgagaactg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page