(data stored in ACNUC7421 zone)

EMBL: CP000088.PE146

CP000088.PE146       Location/Qualifiers
FT   CDS_pept        173973..174743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0148"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54186"
FT                   /db_xref="GOA:Q47TM8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54186.1"
FT                   /translation="MMAFHVLLLVVVPSFIALGLWQYERAETKAAVVELQEANLAADPV
FT                   PIEELTSVGGEVAPEDRWRRVTVTGTYDPDRELLVRNRSGSGGVGMHVLTPLVTEDGTA
FT                   VLVNRGWVAQPPTATESPEVPPAAQGEVTVTGRLQVSETPESTGIHSRDGLPEGQIMLI
FT                   DVPAIAADLPYEVYGGYVELVEETPAPAAAPEPVEVTKVNTGMNFSYAVQWWTFTVIAV
FT                   GGWVFLVRREVQDAAQKSEPAEPDTVSSTTPNKV"
     atgatggcgt tccacgtgct gctgctcgtg gtggtgccct cgttcatcgc cctggggctg        60
     tggcagtacg aacgggccga gaccaaagcc gcggtagtcg agctgcagga ggccaacctt       120
     gccgccgacc cggtcccgat tgaggagctg acctcggtcg gtggcgaagt cgcccccgag       180
     gaccgctggc ggagggtcac ggtcacgggc acctacgacc ctgaccggga gctcctcgtg       240
     cgcaaccgga gcggttccgg cggggtcggg atgcacgtcc tcaccccttt ggtgacggag       300
     gacggcacag cggtactcgt caaccgggga tgggtggcgc agccgcccac ggcgaccgag       360
     agtcccgagg tgccgcccgc tgcccaggga gaagtcaccg tgacggggcg gttgcaagtc       420
     tcggagaccc cggagagcac cggcatccac tcccgggacg ggcttcccga agggcagatc       480
     atgctcatcg acgtgcccgc cattgccgca gacctcccct acgaggtgta cggggggtat       540
     gtggaactgg tcgaggagac cccggctccc gcagccgcgc ccgaaccggt cgaagtgacc       600
     aaggtcaaca cggggatgaa cttctcctat gcggtccaat ggtggacgtt cacggtgatc       660
     gccgttggcg gatgggtttt cctggtccgc cgtgaagtcc aggacgcggc acagaaatcg       720
     gaacccgccg agccggacac cgtttcttcc accactccga acaaggtgtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page