(data stored in ACNUC7421 zone)

EMBL: CP000088.PE149

CP000088.PE149       Location/Qualifiers
FT   CDS_pept        176721..176981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54189"
FT                   /db_xref="GOA:Q47TM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54189.1"
FT                   /translation="MNGMEFGLLLMALLAVIIPVGVIITVVVVLWHAQRSAERQVRSPE
FT                   FWERRRLESDSLLRDLDRQLAEGEIDRAEYEQRREKYRAAR"
     atgaacggca tggaattcgg gctcctgctg atggccctgt tggccgtgat cattccggtg        60
     ggggtgatca tcaccgtcgt ggtggtgctc tggcacgcgc agcggtccgc ggagcggcag       120
     gtccgttcac cagagttctg ggagcggagg cggttggaga gcgattcgct gctccgggac       180
     ctcgaccggc agctcgctga gggagagatc gaccgcgcag agtacgagca gcgccgggag       240
     aagtaccggg cggcgcggta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page