(data stored in ACNUC7421 zone)

EMBL: CP000088.PE157

CP000088.PE157       Location/Qualifiers
FT   CDS_pept        184472..184714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54197"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54197.1"
FT                   /translation="MRGCRPGSGLFAPLPALDCLTVGGRDSLVINQRLRFAVFVGPGRA
FT                   AAFECPLDLVFEALVESGTVFIAAALHEGCLPSTS"
     gtgcgggggt gcagaccggg cagcggctta ttcgctccgc tgcctgcgct ggattgcctc        60
     acggtcggtg gccgggattc cctcgtcatc aaccaaaggc tccggttcgc ggtcttcgtg       120
     ggcccgggtc gggccgccgc ttttgagtgc cccctcgatc tcgtgtttga ggctctcgtc       180
     gagtcgggga ccgtgtttat cgctgccgcg ctccatgagg ggtgtctccc ttccacctcc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page