(data stored in ACNUC7421 zone)

EMBL: CP000088.PE159

CP000088.PE159       Location/Qualifiers
FT   CDS_pept        186124..186354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54199"
FT                   /db_xref="GOA:Q47TL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54199.1"
FT                   /translation="MRRGSLKGPLGSHDRPASALTFRLVLAVFGAVVLLVGAVLAAVWA
FT                   DSVPLAVVLGAGFLAACLNVYWVSRRRRYER"
     atgcgacgcg gaagtctcaa agggccgttg ggaagtcacg accggccggc gagcgcgctg        60
     acgttccgcc tggtcctcgc tgtcttcggt gcagtggtgc tcctggtggg agcggtgctc       120
     gccgcggtgt gggcggactc cgtgccgttg gcggtcgttt tgggtgcggg tttcctcgcg       180
     gcgtgtctga acgtctactg ggtgagtcgc cgccgccgct acgagcggtg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page