(data stored in ACNUC7421 zone)

EMBL: CP000088.PE162

CP000088.PE162       Location/Qualifiers
FT   CDS_pept        190024..190854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54202"
FT                   /db_xref="GOA:Q47TL2"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54202.1"
FT                   /translation="MRVPLLLRPRWLGIHLLALLAVLTCTLFGYWQYERAQRPDRETVT
FT                   NPVADLAAAVDISTLLRPGEYMPQDLANEAVVVTGTYDAEHQLLSPALSPDGAEGYSVV
FT                   IPLVTEDGVAVAVNRGWIPLDAADEVPPPPDGEVTVRGWLQLPQDEASRGYSAILPEGQ
FT                   IARISSALLVNEWPYQLYEGYVTLGEQSPPTPAGAGSALEEFPPPDPPQGIVWNFRNLS
FT                   YAAQWWVFGLAAIVFWVSLMRRELDDHRKARQDGGAAAEGPAEPAQPSAEMVAD"
     gtgcgtgtcc cactccttct gcgaccccgc tggctcggta tccacctgct cgcgctcctc        60
     gcggtgctca cctgcaccct gttcggctac tggcagtacg aacgggcgca gcggccggac       120
     cgtgagacgg tgaccaaccc ggttgcggat cttgccgcgg cggtggatat cagcacgctg       180
     ctccgccccg gcgagtacat gcctcaggac ctcgctaacg aggccgtggt cgtgacgggg       240
     acctacgacg ccgagcacca gttgctctcc ccggcgctgt ccccggacgg cgctgaaggg       300
     tactccgtgg tgattccgct ggtgaccgag gacggcgtcg cggtagcggt gaaccggggg       360
     tggatccccc tcgacgccgc cgacgaggtt cctcccccgc cggacggcga ggtcacggtc       420
     cgcggctggc tccagttgcc gcaggacgag gcgtcacgcg gctattcggc gatcctcccg       480
     gaggggcaga tcgcgcggat ctcctccgcc ctgctggtca acgagtggcc ttaccagctc       540
     tatgaggggt acgtcacgct aggggagcag agtccgccga cgcccgccgg agcggggagt       600
     gcgttggaag agttcccgcc gccggacccg ccacagggga tcgtgtggaa cttccggaac       660
     ctcagctatg ccgcccagtg gtgggtgttc gggctggccg ccatcgtgtt ctgggtctcc       720
     ctgatgcggc gggagctgga cgaccaccgg aaggcgcggc aggacggcgg tgcggcggcc       780
     gagggccctg ccgaaccggc tcagccgtcg gcggagatgg tcgccgactg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page