(data stored in ACNUC7421 zone)

EMBL: CP000088.PE163

CP000088.PE163       Location/Qualifiers
FT   CDS_pept        complement(190824..191249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54203"
FT                   /db_xref="GOA:Q47TL1"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54203.1"
FT                   /translation="MENKRLPLTVYRVLAYVTSTWLLLLTFVAMPAKYLVGETAQFSVV
FT                   PAPAGLEQWFGAETPLMMYIAIPHGYIYMVFVLSVLWLALKRRWNALRTVGVMLSGTIP
FT                   VVGFFVERKIAAEEQAAIDAEEQTSGAAQSATISADG"
     gtggagaaca agcgtcttcc tctcacggtc taccgtgtcc tggcctacgt cacttcgacg        60
     tggctgctgc tgttgacgtt cgtggcgatg cccgccaaat acctcgtcgg ggagaccgcc       120
     cagttctccg tggttcccgc ccccgccggc ttggagcagt ggttcggtgc ggagactccg       180
     ctgatgatgt acatcgcgat cccgcacggc tacatctaca tggtgttcgt gctgtccgtg       240
     ctgtggctgg cgctcaagcg ccggtggaac gcgctccgga ccgtcggggt catgctgtcc       300
     ggcacgatcc cggtcgtggg attcttcgtg gaacgcaaga tcgcagccga ggagcaggcc       360
     gcgatcgacg cggaagagca gacgtccggt gccgctcagt cggcgaccat ctccgccgac       420
     ggctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page