(data stored in ACNUC7421 zone)

EMBL: CP000088.PE168

CP000088.PE168       Location/Qualifiers
FT   CDS_pept        complement(195927..196280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54208"
FT                   /db_xref="GOA:Q47TK6"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54208.1"
FT                   /translation="MSGPRERDPGLQPERTLLSWQRTLFLLAVVTLLYLRVPPEDTLAG
FT                   TVGQLIAVGILFGTSTVLAVHLQKRWRQTDHGRRADGSLRPPAPLARPWALVAVSLAVL
FT                   GISVIAIVSAFPA"
     atgagcggcc cccgcgaacg cgacccgggc ttgcagccgg aacggaccct gctgtcctgg        60
     cagcgcactc tgttcctgct cgctgtggtg accctgctgt atctgcgggt cccgcccgag       120
     gacacgctgg ccggtacggt cggccagctc atcgcggtgg gcatcctgtt cggcacgtcc       180
     accgtactcg ccgtgcacct gcagaaacgc tggcggcaga ccgaccacgg ccggcgtgcc       240
     gacggctcct tgcgaccgcc cgcgcccctg gcccgcccgt gggcgctcgt cgccgtgagc       300
     ctcgccgtcc tggggatcag cgtgatcgct atcgtctctg cttttcccgc gtaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page