(data stored in ACNUC7421 zone)

EMBL: CP000088.PE175

CP000088.PE175       Location/Qualifiers
FT   CDS_pept        complement(200301..200744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54215"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54215.1"
FT                   /translation="MERRFQVALPRAAYTVPVLRSFLGCALHVHGVCPECQRDILVAAS
FT                   EACANVIDHGAPASDYQVSVSIEQACCVIRITHNGRHFTPTIAPPRPAPDSESGRGIFL
FT                   MHALMDEVVFDVEPDGRTTVLLVKRLCLLPAAKRPLTPAVASG"
     atggaaaggc gattccaggt cgcactgccg agggcggcgt acacggtccc cgttctgcgt        60
     agcttcctag gctgtgccct gcacgtccac ggtgtctgcc ccgaatgcca gcgcgacatc       120
     ctggtggcgg cctcggaagc ctgcgcgaat gtgatcgacc acggcgctcc ggcatccgac       180
     taccaggtct cggtcagcat tgagcaggcc tgctgcgtca tccgcatcac tcataacggc       240
     cggcatttca ctccgacgat cgccccgccc cgccctgctc cagattctga gtcaggtcgg       300
     ggtattttcc tcatgcacgc cctcatggac gaggtcgtgt tcgacgtcga gcccgacggg       360
     cggaccacgg tactgctcgt caaacggctc tgcctgctgc cggcggcgaa acgcccgctc       420
     accccggccg tggccagcgg gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page