(data stored in ACNUC7421 zone)

EMBL: CP000088.PE183

CP000088.PE183       Location/Qualifiers
FT   CDS_pept        complement(209081..209806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0185"
FT                   /product="preprotein translocase YidC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54223"
FT                   /db_xref="GOA:Q47TJ1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54223.1"
FT                   /translation="MFGLFSAFLAAAHALTMAVHSTLAVFLGPVSAAATIAFLTLAARV
FT                   LTLPLSYLQVRGEKIRARLAPQLYALRERYGHNPERLVAKTRELYAREGASPFAGCLPA
FT                   LAQAPMFTLLYTLFTVPEIDGSANALLALPFAGTPLGSTLPRILASGDLGALPVFAALL
FT                   AALAAVAWANRRWLTLPALSAAPAAGQPTPVPAFVTYLPFLTVVIAAFVPLASGIYLVT
FT                   STTWTVVERLTLRRLVRVD"
     gtgttcggtc tgttctctgc gttccttgcc gctgcccacg ccttgaccat ggcggtccac        60
     agcaccctgg ccgtgttcct cggtccggtg tccgccgcag caacgattgc cttcctgacc       120
     ctcgccgccc gcgtactcac gcttcccctc agctacctcc aggtgcgcgg ggagaaaatc       180
     cgcgcccgcc tggcgcccca gctttacgcg cttcgggagc gttacggcca caacccggag       240
     cgcctcgtcg cgaagacccg ggaactctac gcccgcgaag gcgcctcacc gttcgccgga       300
     tgcctgcctg cgctcgccca agcaccgatg ttcaccctgc tctacaccct gttcacggtt       360
     ccggagatcg acggctccgc caacgcgctc ctcgcgctgc cgttcgcggg aaccccgctg       420
     gggtcgaccc tgccgcgcat cctcgcgtcc ggtgacctcg gagctctccc cgtgttcgct       480
     gcgctgctcg ccgcactggc cgcggtggcg tgggccaacc gacggtggtt gaccctgccc       540
     gcactctccg ctgccccggc tgcgggacag cccacccccg tgccggcgtt cgtcacctac       600
     ctgccgttcc tgaccgtggt catcgccgcg ttcgtcccct tggcctccgg gatctacctg       660
     gtgacctcga ccacgtggac agtggtggaa cgcctcacgc tgcgccgtct cgtccgcgtt       720
     gactag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page