(data stored in ACNUC7421 zone)

EMBL: CP000088.PE184

CP000088.PE184       Location/Qualifiers
FT   CDS_pept        complement(209915..210253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54224"
FT                   /db_xref="GOA:Q47TJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54224.1"
FT                   /translation="MSTDRQKDPVRIPTGGAVAFLIFLAQSFLVGVDSVPLDPASLTVA
FT                   ATLAVGAALLWLALPARPVRTESATEPYARTSALRRWQQRVGVVVSAAPNVPGKPRSRA
FT                   PGAAATAA"
     gtgtcaacgg accgacagaa agatccggtg cggataccga cgggaggtgc tgtggcgttc        60
     ctgatcttcc tcgcccagtc cttcctggtc ggggtggaca gtgtcccact ggacccggct       120
     tcgctcaccg tggcggccac actggccgtg ggcgcggccc tcctgtggct ggcccttccc       180
     gcgcgcccgg tccggaccga atccgcaacc gaaccctatg cccggacgag tgccctgcgc       240
     cgctggcagc agcgcgtcgg cgtggtcgtc tccgcggctc ctaacgtgcc cggtaaaccc       300
     cggtctcggg ctcccggcgc ggccgctacg gccgcgtga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page