(data stored in ACNUC7421 zone)

EMBL: CP000088.PE187

CP000088.PE187       Location/Qualifiers
FT   CDS_pept        complement(211440..212459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0189"
FT                   /product="putative PfkB-family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54227"
FT                   /db_xref="GOA:Q47TI7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54227.1"
FT                   /translation="MTETDSYDVICIGETMGQLSPASAVPLVEQPPLLPRIGGAESNVA
FT                   CGLAGLGHRVAWMSRVGDDPFGAIITRTLARYGVDTSLVEVDQERPTGLYLKDPAPKGT
FT                   RVYYYRRESAASAIGPRLAERPELRTARLLHLSGITPALSTSCAAFVQRLFVSRPAHGP
FT                   LLSFDVNYRPALWPADDAAPVLLDLARAADLVFVGRDEAEQLWQASTADQVRALLPDVP
FT                   LLVVKDADVGATSYTGARRVFVPAPRVDVVEAVGAGDAFAAGFLSGLLDDRTPEECLRL
FT                   GHIMAAATLLSVADLAPFPPREARERLLALSPAAWAALCIPDPDLFPLDPSDPLFSGA"
     gtgaccgaaa ccgattccta cgacgtgatc tgcatcggcg agaccatggg acagctctct        60
     cctgcctcgg cagtcccgct ggtcgaacag ccgccgctgc tcccgcggat cggcggcgca       120
     gagtccaacg tggcctgcgg cctcgccgga ctgggccacc gggtcgcctg gatgagccgg       180
     gtaggagacg accccttcgg ggcgatcatc acacggaccc tggcccgcta cggggtggac       240
     accagtctgg ttgaggtcga ccaggagcgc cccaccggcc tctacctcaa agaccctgcg       300
     cccaaaggca cccgggtgta ctactaccgg cgcgaatctg ctgcctccgc gatcggcccc       360
     cgcctggcgg aacggccgga gctccgcacc gcccggctcc tccacctgtc cggtatcacc       420
     ccggccctct ccaccagttg cgccgcgttc gtccagcggc tcttcgtctc ccggcccgcg       480
     cacgggccgc tgctctcctt cgacgtcaat taccgtcctg ccctatggcc ggccgacgac       540
     gctgcccccg tgctcctcga cctggcccgc gcagccgacc tcgtcttcgt cggccgcgac       600
     gaagcggaac agctctggca ggcctccacc gccgaccagg tgcgggcgct cctgccagac       660
     gtaccgctcc tcgtcgtcaa agacgccgac gtgggcgcca cctcctacac cggggcccgg       720
     cgggtcttcg ttcccgcgcc ccgcgtcgac gtggtggaag ccgtcggtgc cggagacgcc       780
     ttcgcggcgg gcttcctctc cggtctgctg gacgaccgca cacctgagga atgcctgcgg       840
     ctagggcaca tcatggccgc ggccaccctg ctcagcgtcg cagacctggc tccgttcccg       900
     ccccgggagg ctcgagagcg tctgctcgcc ctgtccccgg ccgcctgggc ggccctctgc       960
     atccccgacc cggacctgtt ccccctcgac ccgtccgacc ccctcttctc cggagcgtga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page