(data stored in ACNUC7421 zone)

EMBL: CP000088.PE197

CP000088.PE197       Location/Qualifiers
FT   CDS_pept        225460..225903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0199"
FT                   /product="regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54237"
FT                   /db_xref="GOA:Q47TH7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54237.1"
FT                   /translation="MNDATFGEDTPVYVISVAAELSGLHPQTLRQYDRLGLVRPGRTPG
FT                   RGRRYSMRDIQMLREVQRLSQEEGINLAGIKRILELQREVAELREHIFHLHNELNAARS
FT                   AVAARRASSDHSSSSRSGGELLPVHRTRITIFNRTTTQPPESQ"
     atgaacgacg ccacgttcgg cgaggacact cccgtctacg tcatttcggt tgcggcagaa        60
     ctgtcggggc tccacccgca gactctgcgg caatacgacc ggctcgggct cgtgcgtccg       120
     gggcggacgc cgggccgtgg ccgacggtac tcgatgcgcg acatccagat gctccgcgag       180
     gtgcagcggc tctcccagga ggagggcatc aacctcgccg ggatcaaacg catcctcgaa       240
     ctgcaacgcg aggtggcgga gctgcgcgag cacatcttcc acttgcacaa cgagctgaac       300
     gcagcccgct ccgcggtggc ggcccggcgg gccagcagcg accactcctc ctcatcccgg       360
     agtggcggcg aactgctccc ggtccaccgc actcgcatca ctattttcaa ccgcaccacg       420
     acccagcccc ccgagtcgca gtag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page