(data stored in ACNUC7421 zone)

EMBL: CP000088.PE20

CP000088.PE20        Location/Qualifiers
FT   CDS_pept        complement(27533..28045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54060"
FT                   /db_xref="GOA:Q47U04"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54060.1"
FT                   /translation="MKLVTPGDSAPASVNRYLLPHEQQVITVRRHPAVLLGPTAIVLGS
FT                   LIAAGILSNTSFVTSGAMLAIIWWLWLLVLVWFVWKVAEWSVDYFVITSARLLGTNGLI
FT                   TRQVNMMPLGKVTDMRFERTLLGRLLGYGTFVMESAGQDQALSKIDFIPYPEQLYLEVV
FT                   GLIFPDK"
     atgaagctgg tgacaccggg cgactcggcg cccgcgtcgg ttaaccgcta cctgctcccc        60
     cacgagcagc aggtcatcac ggtccgccga caccctgctg tcctgttggg gccgacggcg       120
     atcgtgctgg gcagtctgat cgccgcgggg attctgagca acacctcgtt cgtgacgagc       180
     ggggccatgc tggccatcat ctggtggctg tggctgctgg tgctggtgtg gttcgtatgg       240
     aaggtcgccg agtggtcggt cgactacttc gtcatcacgt cggcgcgcct gttgggcacg       300
     aacggcctga tcacccggca ggtcaacatg atgccgctgg gcaaggtcac cgacatgcgc       360
     tttgaacgca ccctgttggg ccgcttgctg ggctacggca cgttcgtcat ggagtcggcc       420
     ggtcaggacc aggctctcag caagatcgac ttcatcccct acccggagca gctttatctc       480
     gaagtggtgg gcctcatctt ccccgacaag tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page