(data stored in ACNUC7421 zone)

EMBL: CP000088.PE200

CP000088.PE200       Location/Qualifiers
FT   CDS_pept        complement(229336..229899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0202"
FT                   /product="conserved hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54240"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54240.1"
FT                   /translation="MNDARVVETLGGCRVDGVPVRHGRALELVAVLALAKGSAPRDWLL
FT                   STLFEGDPAPSSLPTLALRARKLGIDVRYDRDRCCYLLAGEVRCDVVEVLELVEEGRLA
FT                   EAVARYRGPFLPKSYSPFAVQMRASLEERLVRAALLSDDVALMASVDRVVKHPELSQEL
FT                   VRRGGDAVVVSLSRSWLAGLEAAI"
     atgaacgatg cacgcgtagt ggagacgctt ggcggatgcc gggtggacgg ggtcccggta        60
     cggcacggcc gggcgttgga gctcgtggcg gtgctggcgt tggcgaaggg gtcggcgccg       120
     cgggactggc tgctgtccac tctgttcgaa ggcgaccccg ccccgtcgag tttgccgacg       180
     ctggcgctgc gggcccgcaa actcggcatc gacgtgcgct acgaccgcga ccgctgctgc       240
     tatctgctgg cgggtgaggt gcgctgcgac gttgtcgaag tgctggagct ggtggaagag       300
     ggccggctgg ctgaggcggt cgcccgttac cgggggccgt tcctgccgaa aagctacagc       360
     ccgttcgcgg tgcagatgcg ggcgagtctg gaggagcggc tggtccgcgc ggctctgctc       420
     agcgacgatg tcgcgttgat ggcgtcggtg gaccgggtgg tcaagcaccc ggagctcagc       480
     caggagctgg tgcgccgggg aggcgacgcc gtggtggtct cgctcagccg gtcgtggctg       540
     gccggtctcg aagccgcgat ctag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page