(data stored in ACNUC7421 zone)

EMBL: CP000088.PE209

CP000088.PE209       Location/Qualifiers
FT   CDS_pept        complement(239062..240729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54249"
FT                   /db_xref="GOA:Q47TG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54249.1"
FT                   /translation="MPQGCTAPSVRSAAAPRDCRDPGRAPGVGLRRSVFRSHAGTQFAD
FT                   WSGLQDACHGRGGRGRHSCTPASDPRPGPAVPAFPACGRLVCAGNSAVACDSGHGPVLP
FT                   FSARSLVRAAHPGLACRTMAAQSSRSSRTPRRPAPPATGTSSRVAVIAMAVLCVTAIAA
FT                   CAILLSYNGIFQIALRGGVTGWAAHLYPGMFILLLLMAFWAIYLLRDAPRRRRIWVDLL
FT                   VLAMILAAAGASALHSLHYELVEWAATLVVAGGPWLALLISFRLLLWIVAQVRGERVAV
FT                   AGEPAAEEPAAGPAPDSPAAPAVEEEPVAVDSGSPAEPPTEPLAVLPRTETSPAATAAP
FT                   SSSEETAPLVSSTPAPRPAAADISAEADLGDDTVRPAPAEQSTAPPEPDRAADERGSLP
FT                   KRVPPAEGSAIRRAAEPSDRPPAAVADEPAELSAGSAVDAELDDADWESITDAEDDWET
FT                   GDTPLADDPSEDETHSEPAEVAAAPQAAPRSSAAGAPHPVSREEAAADDAASVPEQSPP
FT                   PAPRLRRRPIVLRPRRSSPPPLRPPSSEVRSSPTPPEE"
     gtgccgcagg gctgcactgc cccctctgtc cgttctgccg cggcgccaag agactgtcgg        60
     gatccgggcc gggcgcccgg cgtcgggttg cggcgttccg tttttcgctc acatgcgggc       120
     acacaattcg ctgattggtc cggtctgcag gacgcgtgcc acgggcgggg cgggaggggg       180
     aggcactcgt gcactcctgc ttccgaccct agacctggcc ctgccgtacc ggctttccct       240
     gcctgcggcc gactggtgtg cgcggggaac agcgccgtgg cgtgtgacag cggacacggt       300
     cctgtcctgc cgttttcggc cagaagcctc gtccgagcag cgcatcctgg gttagcctgc       360
     cgcacgatgg cagctcaatc ctcccgatcg tcccgcacac cccgtcgccc ggctccgccc       420
     gcgacgggca cgtcgtcgcg cgtagccgtg atcgcgatgg ccgtgctctg cgtcaccgcg       480
     atcgctgcgt gcgccattct gctgtcctac aacggcatct tccagatcgc cctgcgcggt       540
     ggtgtaaccg gctgggcggc gcacctgtac ccggggatgt tcatcctgct gctgttgatg       600
     gcgttctggg ccatctacct gctccgggat gccccgcggc gccgccggat ctgggtggac       660
     ctcctggtcc tggcgatgat cctggccgcg gcgggcgcca gtgcgctcca ctcgctccac       720
     tacgagctgg tggagtgggc cgccactctc gtcgtcgcgg gcggtccgtg gctggcgctg       780
     ctgatctcgt tccggctgct gctgtggatt gtcgcgcagg tccggggcga acgcgtcgcc       840
     gtggcgggag agcccgcagc cgaggagccg gcagccggtc ccgcaccgga cagcccagcg       900
     gccccggccg tggaagagga gccggtggcg gtagacagcg gttctccggc agaacccccc       960
     actgagccgc tcgcggtgct cccgcgcacg gagacgtctc ccgccgcgac ggcagcgccg      1020
     tccagcagcg aggagacagc cccactggtg tcttcgaccc ctgcgccgcg ccctgcggca      1080
     gccgacatct ccgcggaagc ggacctgggc gacgacacgg tccgcccggc cccggcagag      1140
     cagtccaccg ccccgcccga gcctgaccgt gccgcggatg agcggggaag cctaccgaaa      1200
     cgcgtccccc cggctgaggg cagcgcgatc cgtcgggccg cagaaccctc ggaccgtccc      1260
     cccgctgcgg ttgcggacga gcctgcggag ctgtccgccg gcagtgccgt ggacgcggag      1320
     ctcgacgacg cggactggga gagcatcacc gacgcggagg acgactggga gaccggtgac      1380
     actccgctcg ccgacgatcc cagcgaggat gagacgcact ccgagcccgc ggaggtcgct      1440
     gctgcgccgc aggccgcccc acgctcttcg gctgctggtg cgccacaccc cgtatcccgg      1500
     gaggaggccg ccgcggacga tgcggcttcc gtgccggagc agtcgccccc gcccgcaccg      1560
     cggcttcggc gccgccctat cgtgctccgg ccccggcgga gcagtcctcc gccgctgcgc      1620
     ccgccctcca gtgaggtgcg gagcagcccg acaccgccgg aagagtga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page