(data stored in ACNUC7421 zone)

EMBL: CP000088.PE214

CP000088.PE214       Location/Qualifiers
FT   CDS_pept        complement(244725..245561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0216"
FT                   /product="helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54254"
FT                   /db_xref="GOA:Q47TG0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54254.1"
FT                   /translation="MASPTVRRRQLSAILREMRKASGLSLDAVAARLEWSRAKVGHIET
FT                   GQRKKPSVLEVKALMAEYGVTPEDPRYETVLMLTRQAQARGWWRRYDDLFPGSYIELEA
FT                   EASEIRTYEAFVVPGLLQTPGYTRLLQQARLDRDPDDVERAVESRRKRQEIFDRTSPPA
FT                   VYAIIEEHALERLRGTPDVLAEQVAHLLHMAGRNSVTLQVLRTRVGVHAGAMGPFVILD
FT                   FPEPASPVVYLETYTDGLFLERREEIDQYRSLWDRIRDAALPPDRTVEFLRSLLTL"
     atggccagtc ccacggtgcg ccgccgccag ctctccgcga tcctgcggga gatgaggaag        60
     gcgtcggggc tcagccttga tgccgtagct gcgcgcctgg agtggtcgcg cgcgaaggtg       120
     gggcacatcg aaaccggaca gcgcaagaaa ccgtccgtgc tcgaagtgaa ggcgttgatg       180
     gccgagtacg gggtgacgcc cgaggaccct cgatacgaga ctgtgttgat gttgacccgg       240
     caggcccagg cgcgtggctg gtggcgccgg tacgacgacc tgttccccgg gtcatatatc       300
     gagctggagg ctgaggcgtc cgagatccgc acctacgagg cgttcgtagt cccggggctg       360
     ttgcagacgc ccggctatac acggctgctc cagcaggccc gcctggaccg tgacccggat       420
     gatgtcgagc gcgctgtcga gagccgccgt aagcggcagg agatcttcga ccggacgtcc       480
     ccgcccgcgg tgtatgccat catcgaggaa catgcgttgg agcggctgag gggcacccct       540
     gacgtgctgg ctgagcaggt cgcgcacctg ctgcatatgg ccggccggaa ctccgtgacg       600
     ctccaggtgc tccgcacccg tgtcggggtg cacgcggggg cgatgggacc gtttgtcatc       660
     ctggacttcc cggaaccagc atccccggtc gtgtacttgg aaacatacac agatggcctg       720
     ttcctggagc gccgagagga gatcgaccag taccggtcgc tatgggaccg catccgtgat       780
     gcggctctgc caccggaccg gacagtggaa ttcctccgct ccctgctgac cttgtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page