(data stored in ACNUC7421 zone)

EMBL: CP000088.PE217

CP000088.PE217       Location/Qualifiers
FT   CDS_pept        247449..247931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54257"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54257.1"
FT                   /translation="MRTAPPAHAQPASGSCSLRAQEESTVCRVSRFFPAAGEPGKPARQ
FT                   ATAAAGVPERAERARSVLSQRGLGAEADAAQSAPQRRSDEAGGAGTVFRGAHEPWSAPD
FT                   DRAEARGRSAGLLSSAWRESMRGGLQLCRMAPELPLPRGVLLWRLVDAGRAQPPAQ"
     gtgcgcaccg cgcctccggc gcacgcacag cccgcttctg ggagctgctc tctccgcgcg        60
     caggaagaga gcacggtgtg tcgggtgtcc cggttcttcc ccgcagcagg agagcccggg       120
     aagcctgccc ggcaggccac tgccgcagcg ggagtcccgg agcgtgcgga acgggctcgt       180
     tcggttctgt cccaacgcgg cctcggagca gaggccgatg cggcccagtc tgccccccag       240
     cggaggtccg acgaggcagg cggagccggg acggtcttcc gaggggcgca cgaaccctgg       300
     agtgcccccg acgacagggc agaagcccgg ggccggtctg ctggtctcct gtcctcagcg       360
     tggcgagagt cgatgagggg cggacttcag ctgtgccgca tggcccccga acttcccctt       420
     ccccgtggag tactcctgtg gcggctggtc gacgcaggcc gtgcgcagcc gcccgcgcaa       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page