(data stored in ACNUC7421 zone)

EMBL: CP000088.PE22

CP000088.PE22        Location/Qualifiers
FT   CDS_pept        complement(28370..28594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54062"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54062.1"
FT                   /translation="MSQTHDALSRDLAPVVTRLSAEFKDVHPESIVSRCVTAARNGAED
FT                   VVGYATPELVERIARQHLKVLALALAEQR"
     atgtcccaga cccatgacgc gctctcgcgc gacctcgccc ccgttgtcac gcgactcagc        60
     gccgagttca aggacgtgca cccggaatcg atcgtgtccc gctgcgtcac cgcggcccgg       120
     aacggggcgg aggacgtggt cggctacgcc actccggagc tcgtggagcg gattgcgcgg       180
     cagcacctga aagttctcgc cttggccctg gcggagcagc gctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page