(data stored in ACNUC7421 zone)

EMBL: CP000088.PE220

CP000088.PE220       Location/Qualifiers
FT   CDS_pept        complement(250690..251535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54260"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54260.1"
FT                   /translation="MTDHGGYTCLTFLTDYGTQDGFVAACRAQMLRHAPGLPVIDITHD
FT                   IPPGDVRRGATVLADTVPEFPAAVHIGVVDPGVGTARRSVALAAGGHVLVGPDNGLLVW
FT                   AAEALGGIDTAVELTNESLWRHPVSRTFHGRDIYAPVGARIAAGLPLSEAGQALDPAVL
FT                   VRLSAPLRDVSGGVARGEVHAIDRFGNCQLSLHPEDLRSVVAAPGLPDRVAVRLPDGSH
FT                   TVAVAATFGAVPLGEPVLLTDSAGLLALAVNGGSAAQRFGLGVGAPVVLSRTSSEPMKE
FT                   "
     atgactgacc atgggggata cacctgtctc actttcctga ccgattacgg gacccaggac        60
     ggtttcgtgg ccgcctgccg cgcccagatg ctgcggcacg cacccgggct ccccgtcatc       120
     gacatcaccc acgacatccc gcccggggat gtgcggcgcg gcgccaccgt gctggccgac       180
     acggttcccg agttcccggc cgcggtccac atcggcgtcg tcgacccggg ggtggggacc       240
     gcgcggcgca gtgtggccct tgccgccgga ggccacgtcc ttgtagggcc ggacaacggg       300
     ctgctggtct gggcggcgga agccctcggc gggatcgaca cggccgtgga gttgaccaac       360
     gagtcgctgt ggcggcaccc ggtctcccgc acgttccacg ggcgggacat ctacgccccg       420
     gtgggggcac gaatcgcggc cgggcttccc ctgtccgaag cggggcaggc cctcgacccg       480
     gcggtcctgg tgcggctgtc cgctccgctc cgcgacgtca gcggtggagt ggcccgcggc       540
     gaagtgcacg ccatcgaccg gttcggcaac tgccaactgt cgctgcaccc ggaagacctg       600
     cggtccgttg tcgcggctcc gggactcccg gaccgggtgg cggtgcgctt gccggacggt       660
     tcgcacacgg tcgccgtcgc cgcaacgttc ggcgcggtcc ccctcggcga gccggtgctc       720
     ctcaccgact cggccgggct gctggcgctc gcggtgaacg ggggaagcgc cgcccagcgg       780
     ttcggcttgg gcgtgggggc gcccgtagtc ctgtcccgga ccagttcaga gcccatgaaa       840
     gaatga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page