(data stored in ACNUC7421 zone)

EMBL: CP000088.PE229

CP000088.PE229       Location/Qualifiers
FT   CDS_pept        complement(259546..259953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54269"
FT                   /db_xref="GOA:Q47TE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54269.1"
FT                   /translation="MNSQWPGPGNPWGDRTASPPPHHPGSGPPGVPGFSWHASPQPGFP
FT                   PPPPAGEPSFPGPPLAKGNAVLALIIAIILTLTCVGITDVIGIVLAAVALSKDEDPEEF
FT                   DRYVRWAWLSNFIHLGFLILLLVLFIMLSTV"
     atgaacagcc agtggcccgg cccgggcaat ccctggggcg accgcaccgc ctctcctccg        60
     ccgcaccacc ctggaagcgg cccgcccggg gttcccggct tctcctggca cgcttctccc       120
     cagcccgggt ttcccccgcc tcccccggcg ggagagccgt cgtttcccgg tcccccgctg       180
     gccaaaggca acgcggtcct cgccctgatc atcgcgatca tcctcacgtt gacctgcgta       240
     ggcatcaccg acgtgatcgg gatcgtgctg gccgccgtcg ccctcagcaa ggacgaggac       300
     ccggaagagt tcgaccgcta cgtccgctgg gcatggttga gcaacttcat ccacctcggc       360
     ttcctcatcc tgctgctcgt gctgttcatc atgctcagca cggtctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page