(data stored in ACNUC7421 zone)

EMBL: CP000088.PE230

CP000088.PE230       Location/Qualifiers
FT   CDS_pept        complement(260015..260422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54270"
FT                   /db_xref="GOA:Q47TE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54270.1"
FT                   /translation="MSNPPLPPGAADPRDEPLPRARRTAGTQDGDRAEGDAAFRPSGAS
FT                   SSTMALILHALTFLCCGNWLFGILGIVFAVRAAHKRDQGLYTQAETLTRYSWYCLGAGA
FT                   VMLLVMLISFGVLLTQAGSWVEEAISPGVNY"
     atgagcaacc cgccgctgcc cccgggagcc gccgaccccc gcgacgaacc gttgcctcgg        60
     gcccgccgga ccgcaggcac gcaggacggg gaccgcgcgg agggcgatgc ggccttccgt       120
     ccctccggtg cgagcagctc cacgatggcg ctcatcctgc acgcactcac cttcctgtgc       180
     tgcgggaact ggttgttcgg catcctcggc atcgttttcg cggtgcgtgc cgcgcacaag       240
     cgcgaccaag ggctctacac tcaggccgaa actctgacca ggtactcctg gtactgcctt       300
     ggagccggcg cagtgatgct cctggtcatg ctcatctcct tcggtgttct cctcacccag       360
     gcaggatcgt gggtagagga agcaatctca ccgggggtga actactga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page