(data stored in ACNUC7421 zone)

EMBL: CP000088.PE231

CP000088.PE231       Location/Qualifiers
FT   CDS_pept        complement(260468..260734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54271"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54271.1"
FT                   /translation="MPLRYPVTDPQRSLQPFRAAMPLRPAPARGEPLRSPGDNPHRGHD
FT                   RSRTVLPRAGGARHPPAPSAARAAPRSPRQATGLFGTPPQILM"
     atgccgctac gctacccggt gaccgatccg cagcggtccc tgcagccctt ccgagctgcc        60
     atgccactgc ggcccgcacc cgctcgcggt gaaccgctcc ggtcaccggg ggacaatccc       120
     catcgtggtc atgaccgatc ccgcacggta ctgccgcggg caggcggggc acggcatccc       180
     ccggccccgt cggcggcgcg ggccgctccc cgcagccctc ggcaagccac gggcttgttc       240
     ggcactccgc cgcagattct gatgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page