(data stored in ACNUC7421 zone)

EMBL: CP000088.PE233

CP000088.PE233       Location/Qualifiers
FT   CDS_pept        261894..262712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54273"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54273.1"
FT                   /translation="MRRTRRSPVPDKACIEAQDLARAAAVEIGRPEWVGEHLGTKVEDT
FT                   RLVTHFFECLNPAYPGWHYAVTVVRAARAKYVTVNESVMLPGPDALIAPEWLPWKERLR
FT                   PGDLGVGDLLPTPEDDERLMPGYAQVPTEETDADGEDQQMLWELGLGRARVLSEVGRQA
FT                   AAKRWYAGPGGPKSPIATAAPAQCATCGFLVPLAGKLRQMFGVCANEYAPDDGRVVSLD
FT                   HGCGAHSEAAVPERTSERLTPVVDEMGYDTIVFDDTSELELVSSDKQARQ"
     gtgagacgca cccgtcgatc ccccgtacca gacaaggcgt gcattgaggc gcaggatctc        60
     gcccgtgcag cggccgtgga gatcgggcgc ccggagtggg tgggtgaaca cctcggcacc       120
     aaggtcgagg acacccgcct ggtcacccac ttcttcgagt gcctgaaccc cgcctacccg       180
     gggtggcact acgcggtcac ggtggtgcgt gccgcccggg ccaagtacgt caccgtcaac       240
     gagtcggtga tgctgcccgg cccggatgcg ctcatcgcac ccgagtggct gccgtggaag       300
     gagcgcctgc gcccgggcga cctcggggtg ggagacctgc tgccgacccc tgaagacgac       360
     gaacggctga tgccgggcta cgcccaagtc cccaccgaag agaccgacgc agacggcgaa       420
     gaccagcaga tgctgtggga gctgggactg gggcgggccc gcgtgctttc cgaagtggga       480
     cggcaggcag cggcgaaacg ctggtacgcc ggcccgggcg gtccgaagag cccgatcgcc       540
     actgcagccc cggcccagtg cgctacctgc ggtttccttg tcccgttggc gggcaagctc       600
     cggcagatgt tcggggtgtg cgccaacgag tacgcgcccg acgatggccg ggtggtctcc       660
     ctggaccacg gctgcggggc gcattcagag gccgcggtgc cggagcgcac ctctgaacgg       720
     ctcacgccgg tggttgacga gatgggctac gacaccatcg tgttcgacga caccagcgag       780
     ctggagctgg tctcctctga caagcaggcc cggcagtga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page