(data stored in ACNUC7421 zone)

EMBL: CP000088.PE234

CP000088.PE234       Location/Qualifiers
FT   CDS_pept        262990..263649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54274"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54274.1"
FT                   /translation="MRSELFNQAQENDLPGMSLQNPRMLRVVCDGEFYARKGAMVAYQG
FT                   DIDFAHQGSGLGRFTKKMLTGEGLPLMRVFGKGTVFLARDAWEIHILDLEDESITVNGN
FT                   NVLAFEAGLEWDIHRVRGMGIIAGGLFNTVFRGRGRVAVACHGTPVLLNADQMTFVDTK
FT                   AAVAWSTSLTTSLRSTVKAGALIGRGSGEAFQLALEGRGFVLVQASEGGVRAMQQG"
     gtgcggagtg aactgttcaa ccaggcccag gagaacgacc tacccgggat gtcgctgcag        60
     aacccccgga tgctccgcgt cgtctgcgac ggggagttct acgcacgcaa aggcgcgatg       120
     gtggcctacc agggcgacat cgacttcgcc caccagggct cggggctcgg ccggttcacc       180
     aagaagatgc tcaccggcga aggcctgcct ctcatgcgcg tgttcgggaa aggcacggtc       240
     ttcctcgccc gggacgcgtg ggagatccac atcctcgact tggaagacga gtcgatcacc       300
     gtcaacggga acaacgtgct cgctttcgaa gcgggcctgg agtgggacat ccaccgggtg       360
     cggggcatgg gcatcatcgc tggcggcctg ttcaacacgg tgttccgggg ccggggccgg       420
     gtcgcggtcg cctgccacgg caccccggtg ctactcaacg ccgaccagat gactttcgtg       480
     gacaccaaag ccgcggtcgc ctggtccacg tcgctcacca ccagcctgcg cagcaccgtc       540
     aaagcggggg cgctgatcgg ccgcggcagc ggggaggcgt tccagctcgc tttggaaggc       600
     cgcgggttcg tcctcgtgca agcctcggaa ggaggcgtgc gggccatgca gcaggggtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page