(data stored in ACNUC7421 zone)

EMBL: CP000088.PE236

CP000088.PE236       Location/Qualifiers
FT   CDS_pept        complement(266788..268272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54276"
FT                   /db_xref="GOA:Q47TD8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54276.1"
FT                   /translation="MSETFRPFPPHLADRLRHALLDADYTVSGVRDRLGDIAARALARE
FT                   QVVPALRATGGEERLGLLLRLWWLGEAVPQTALRSLPLTDLAEAGLLTIRDGQARALVQ
FT                   IKPWELADGRPYYTVSDLTVRPGQGQPRPDHVVGAGGASATLAQLIVDGPVERALDLGS
FT                   GCGVQSLHLAERATRVCATDVNPRALWMTRLSCALSGVDNVETRQGSLYEPVQGERFDL
FT                   IVSNPPFVITPETARYTYRESDLPGDAVCAALVSAAPAHLTEGGWCQLLANWLHVDGED
FT                   WRDRVGGWVEGTGCSGWVVQRDVQDPAEYVELWLRDSCEAGSPEYAQRYDAWLDYFERE
FT                   GVKGIGFGWICLRNDAAQDATVRVEELRHEIDQPVGPYLPDVVDGAMSAHRLTDAALLA
FT                   ARVALAPGVREERISVPGAPDPERILLRQTQGLRRVAQVGTVEAALAGVCDGTIPVGPL
FT                   LDAIAELIGQDPAVLRERTPASLRGLIAEGFFRVAR"
     gtgtccgaaa cgttccgccc gtttccaccg cacctcgctg accggctccg ccacgccctg        60
     ctcgacgccg actacaccgt ctccggtgtc cgcgaccgcc tcggcgacat cgcggcgcga       120
     gccctcgccc gggaacaagt ggttcccgcc ctgcgcgcta ccggtggaga agaacggctc       180
     ggcctgctgt tgcgcctgtg gtggctcggc gaagcggtac cgcagaccgc gttgcgctcc       240
     ctgccgctca ccgacctcgc tgaggcgggc ctgttgacga tccgcgacgg ccaagcccgc       300
     gccctcgtgc agatcaaacc gtgggaactc gccgacggcc gcccctacta caccgtctcc       360
     gacctgaccg tgcgccccgg gcaggggcag ccgcgccccg accacgtcgt cggcgcaggc       420
     ggcgcctcgg caaccctcgc ccagctcatc gtggacggtc cagtcgaacg cgccctcgac       480
     ctgggctccg gctgcggcgt gcaatcgctg cacttggcgg aacgcgccac ccgggtctgc       540
     gccaccgacg tcaacccgcg cgccctgtgg atgacccggc tgagctgcgc cctctccggg       600
     gtggacaatg tcgaaacccg gcaagggtcg ctgtacgagc cggtgcaggg agaacggttc       660
     gacctcatcg tctccaaccc gccgttcgtg atcaccccgg agacggcccg ctacacctac       720
     cgggaatcgg acctgcccgg cgacgcggtg tgcgccgccc tcgtctccgc tgcccccgcg       780
     cacctcacgg aaggcggctg gtgccagttg ctcgccaact ggctgcacgt ggacggagaa       840
     gactggcggg accgggtcgg cggctgggtc gaagggaccg gctgctccgg ctgggtggtg       900
     cagcgcgacg tccaagaccc tgccgaatac gtggaactgt ggctgcgcga ctcctgcgaa       960
     gcgggcagcc ctgaatacgc ccagcgctac gacgcctggc tcgactactt cgagcgggaa      1020
     ggcgtcaaag gcatcggctt cgggtggatc tgcctgcgca acgacgccgc ccaggacgcc      1080
     accgtgcgcg tggaggagct gcggcacgaa atcgaccagc cggtgggccc ctacctgccg      1140
     gacgtggtgg acggggcgat gagtgcgcac cgcctcaccg acgcagccct gctggcggcc      1200
     cgcgtcgccc ttgcccccgg ggtgcgggag gagcggatca gcgtcccggg tgcgcccgac      1260
     ccggaacgga tcctgctccg ccagactcaa ggcctgcgca gagtagccca agtggggacg      1320
     gttgaggccg cgctcgctgg ggtatgcgac ggcacaatcc cggtgggacc gctcctggac      1380
     gcgatcgcgg aactgatcgg tcaggatcca gcggtgctgc gggagcggac cccggcgtcg      1440
     ttgcgtgggc tcatcgcgga aggctttttc cgagtagccc gatga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page