(data stored in ACNUC7421 zone)

EMBL: CP000088.PE239

CP000088.PE239       Location/Qualifiers
FT   CDS_pept        270407..270862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0241"
FT                   /product="regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54279"
FT                   /db_xref="GOA:Q47U28"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54279.1"
FT                   /translation="MLMNQPHPSTPASTDASLAAALRMAVGRLARRLRAQRPDSSLSLG
FT                   QGSALFTLARHGTMTPGALADHEKVQPPSMTRIIAALEERGLVRRRRHPDDGRQQLVEI
FT                   TEEGIQLVQADHQRREAWLTRQLAELSHEDKEVLRRAAEIMDRLSQS"
     atgctaatga atcagcctca cccatccacg ccagccagca ctgacgcgag cctggccgca        60
     gcgctccgta tggccgtggg gcggctcgcc cgacggctcc gtgcccaacg gcccgactcc       120
     tccctgtccc tgggacaggg atcagcgctc ttcacgctgg cgcgacacgg gacgatgact       180
     cctggcgcgc tcgccgacca cgaaaaagtg cagccgccgt cgatgacccg catcatcgcc       240
     gcgcttgaag agcgcggcct ggtccgccgt aggcgtcacc ccgacgacgg ccgccagcag       300
     ttggtggaga tcaccgagga aggcatccag ctcgtccaag ccgaccacca gcgccgggaa       360
     gcgtggctca cccggcagct tgcagaactg agccacgagg acaaggaggt cctcaggcgg       420
     gcagcggaga tcatggaccg gttgagccag tcgtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page