(data stored in ACNUC7421 zone)

EMBL: CP000088.PE242

CP000088.PE242       Location/Qualifiers
FT   CDS_pept        273047..274111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54282"
FT                   /db_xref="GOA:Q47TD5"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54282.1"
FT                   /translation="MGAMTRGVRGVGVVVLLGVCCIAGAAAPAPATPEPSPTSPSRAVP
FT                   EGTEQLFTLTDPRIAESSGLAVSHRHEDIYWTHNDSGPDYGPTLYAVNGEGDTVATVWL
FT                   AGEGVEARDWEAIGIGVDEHGEPAIYVADIGDNYQGGWPNVRVYRIPEPRELVDQTVTA
FT                   TTFTFVYEDGGRDAEGLLIDPRDNRLYLVSKEFTGGVYAAPEQLDPDGVNTLTRVGSAP
FT                   LFATDAAFSPEGSYYAIRTYWNATLYDASEGVPGRRIATVTLPESDQGESLAFTRDGSA
FT                   LLVGSEGTHSPVWRVPVDEFLDAPPEAADEEPSPEATEEADLSGGGGAGGLILVGAGIA
FT                   AVAILAIVWLARNS"
     atgggcgcca tgaccagagg cgtccgcggc gtgggggtag tcgtcctgct cggagtgtgc        60
     tgtatcgcgg gggctgccgc tcccgcaccg gccacaccag agccttcccc aacctctccg       120
     agcagagcag tgccggaagg gaccgagcag ctcttcaccc tcaccgatcc gcggatcgcc       180
     gaatccagcg ggctggcggt ctcccaccgc cacgaagaca tctactggac ccacaacgac       240
     agcggccccg actacggccc caccctgtat gccgtcaacg gggaaggcga tacggtggcc       300
     accgtctggc tcgccgggga gggggtggag gcccgcgact gggaagccat cgggatcggt       360
     gtcgacgagc atggagaacc cgcgatctac gtcgccgaca tcggagacaa ctaccagggc       420
     gggtggccga acgtccgggt ctaccggatt cctgagccgc gggagctggt cgaccagacc       480
     gtgaccgcga ccacgttcac cttcgtctac gaggacgggg gacgggacgc ggaaggactg       540
     ctcatcgacc cgcgggacaa ccgcctctac ctcgtgtcca aagagttcac gggcggggtg       600
     tacgccgcgc ctgagcagct cgacccggac ggggtcaaca cgctgacccg ggtgggcagc       660
     gccccgctgt tcgccacgga tgcggcattc tcccccgagg ggagctacta cgccatccgc       720
     acctactgga atgcgaccct ctacgacgct tccgaggggg tgccgggacg gcggatcgct       780
     accgtcaccc tgccggaaag cgatcagggc gagtcactcg ccttcacccg cgacgggagc       840
     gccctgctcg tcggtagcga aggcacgcac agcccggtgt ggcgggtgcc tgtggacgag       900
     tttctggacg ctcctcccga ggcagcggac gaagagccgt cgccggaagc gaccgaggaa       960
     gccgaccttt ccggcggggg cggcgcgggc ggcctcatcc tcgtcggggc cgggatcgcg      1020
     gccgtggcga ttctcgccat cgtctggctt gcgcgtaaca gctag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page