(data stored in ACNUC7421 zone)

EMBL: CP000088.PE264

CP000088.PE264       Location/Qualifiers
FT   CDS_pept        296341..296664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54304"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54304.1"
FT                   /translation="MTTTIRHPQPRIRPPRPWIPNDPPETVLPAWMYARREPRFPYRII
FT                   HPDDSRTASTADQAEHLNKQRCTSPRIQSCLGLRTLVLLTSTALLASTVLHACTQLTAF
FT                   CPL"
     atgaccacaa ccattcgtca cccccagcct cgaatacgcc cccctcgtcc ctggatcccc        60
     aacgatccgc ccgaaaccgt gctgccagcg tggatgtacg ctcgccggga accgcgcttc       120
     ccctaccgca tcatccatcc ggacgactct cggacggcga gcaccgccga tcaggcagaa       180
     cacctgaaca agcagcggtg caccagccca cgtatccagt cctgcctagg actgcggacg       240
     cttgtgctcc tcacgagcac ggctctgctg gccagcacgg tgctccacgc ctgcacccag       300
     ctcacagcct tctgcccgct atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page