(data stored in ACNUC7421 zone)

EMBL: CP000088.PE265

CP000088.PE265       Location/Qualifiers
FT   CDS_pept        296910..297866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54305"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54305.1"
FT                   /translation="MNHGTRGPPNLEAAVTGQTRREQVSFDSAGVACAGILYHPAEPAP
FT                   GRQPCVVMAHGFTGTMDRLSHYAQRFADAGLTVLTFDYRNFGASGGQPRQLVDIAGQQA
FT                   DWHAAIRFARSRDDIDPDRIALWGSSLGGGHVLTVAADDQRIAAAVAQIPWLGDWRTTR
FT                   DKLRSLADPSTRKLAVAAVRDAWRAWRGRAPLLVKVVGQPGQAAMFTDPSVRRALNVND
FT                   SEDTLWRNEFAPRAVFSFARYAPGSVVDRITVPVLVCAAEQDQEIPFEYVRKVAARNPR
FT                   IELRGYPGRHWEVYRGGESYERVVADQLVFLRGHLGW"
     atgaaccacg gcactcgagg cccgcccaac ctggaggctg ccgtgaccgg acagacccgg        60
     cgagagcagg tgagcttcga ctctgccggc gtcgcatgcg ccggaatcct ctaccacccg       120
     gcggaacccg cccccggcag gcagccgtgc gtggtgatgg cccacggttt caccggaacc       180
     atggaccgcc tcagccacta cgcgcagcgg ttcgcagacg caggcctcac cgtgctcacc       240
     ttcgactacc gcaacttcgg ggccagcgga ggacaacccc gccaactcgt cgacatcgcc       300
     ggacagcaag ccgactggca cgccgcgatc cggttcgccc gctcccgcga cgacatcgac       360
     cccgaccgca tcgccctgtg ggggtcgtcc ctaggcggcg gccacgtgct taccgtcgca       420
     gcggatgacc agcggattgc cgcagccgtg gcgcagatcc cctggctcgg cgactggcgc       480
     accaccaggg acaaactccg ctcccttgct gatccgagca cccgcaagct ggcggtggct       540
     gcggtgcggg acgcctggcg ggcctggcgc ggtcgggcac cgctgctggt gaaagtcgtg       600
     ggacagccgg ggcaggctgc gatgttcact gacccgtctg tgcggcgggc tctcaacgtc       660
     aacgacagcg aagacacgct gtggcgcaac gagttcgctc cgcgcgcagt gttctccttt       720
     gcccgttatg cccctgggtc ggtggtggac cggatcacgg ttcctgtcct cgtgtgcgcg       780
     gcagagcagg accaggagat tcccttcgag tacgtgcgga aagttgcggc ccgtaatccg       840
     cggatcgagc tgcgcggcta tccggggcgc cactgggagg tctaccgggg cggggagtcg       900
     tatgagcgcg tggtcgctga tcagctcgtg tttctccgcg gccacctggg atggtga          957
//

If you have problems or comments...

PBIL Back to PBIL home page